DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ib and jam2

DIOPT Version :10

Sequence 1:NP_523579.1 Gene:beat-Ib / 34939 FlyBaseID:FBgn0028645 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001072218.1 Gene:jam2 / 779665 XenbaseID:XB-GENE-493973 Length:295 Species:Xenopus tropicalis


Alignment Length:191 Identity:45/191 - (23%)
Similarity:79/191 - (41%) Gaps:19/191 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQKPALKLRRLFIITAIYIASLPGLTVGLRNVNVRIPSAVKRGDNALLICNYDIENDTLYTVKWY 65
            |:.||..: .|....|:......|:.|...|.||:    |:.....:|.|.|.:|       |.:
 Frog     1 MRSPACAI-FLGYFAALCCKETFGVYVSSDNSNVQ----VQEFGEIILSCKYKLE-------KEH 53

  Fly    66 RGRREFYRYTPKENPAWKIFTKTNEIDVE-TAQSNASHVLLRNVPTSISGKFACEVSA--DAPTF 127
            ..|.|:.:..|..:.::..:..|...|:. .|:...|.:.|:|...:.|||:.|||:|  |..:|
 Frog    54 PVRLEWKKVVPNGDISFIYYNNTLAADLRGRAEMIESSIWLKNATRADSGKYRCEVTAPKDNKSF 118

  Fly   128 DTSIVAADMEVVELPTQRPIITGIHSRYRLGDVINGNCSSDYSKPAANLTWWINDIQVPPN 188
            ...::  |::|:..|...  :..:......|..:...|......||:...|:.|.|.:..|
 Frog   119 QEIVI--DLKVLVAPGVP--VCDVPPSAMSGTAVELKCRESEGFPASEYRWYKNGILLAIN 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IbNP_523579.1 Ig 144..>182 CDD:472250 5/37 (14%)
Ig strand B 161..165 CDD:409353 0/3 (0%)
Ig strand C 175..179 CDD:409353 0/3 (0%)
jam2NP_001072218.1 Ig 26..128 CDD:472250 29/114 (25%)
Ig strand B 41..45 CDD:409353 1/3 (33%)
Ig strand C 56..60 CDD:409353 2/3 (67%)
Ig strand E 90..94 CDD:409353 1/3 (33%)
Ig strand F 104..109 CDD:409353 2/4 (50%)
Ig strand G 120..123 CDD:409353 0/2 (0%)
Ig 134..230 CDD:472250 8/44 (18%)
Ig strand B 148..152 CDD:409353 0/3 (0%)
Ig strand C 162..166 CDD:409353 0/3 (0%)
Ig strand E 194..198 CDD:409353
Ig strand F 208..213 CDD:409353
Ig strand G 223..226 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.