DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ib and beat-Va

DIOPT Version :9

Sequence 1:NP_001162987.1 Gene:beat-Ib / 34939 FlyBaseID:FBgn0028645 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001189214.1 Gene:beat-Va / 41578 FlyBaseID:FBgn0038087 Length:300 Species:Drosophila melanogaster


Alignment Length:292 Identity:83/292 - (28%)
Similarity:129/292 - (44%) Gaps:44/292 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LFIITAIYIASLPGLTVGLRNVNVRIPSAVKRGDNALLICNYDIENDTLYTVKWYRGRREFYRYT 75
            :|:..|:.| ..| :...|...::.:|..|...||..|.|:||:...||.:||||:...||:||:
  Fly     7 MFLFIALLI-DYP-IAYALFVTDISVPEIVDFRDNVTLSCSYDMRGHTLNSVKWYKDHEEFFRYS 69

  Fly    76 PKENPAWKIFTKTNEIDVETAQ---------SNASHVLLRNVPTSISGKFACEVSADAPTFDTSI 131
            |..:|.:..|      ||...|         .::..:.|.......:|.:.||||.|||.|..:.
  Fly    70 PLTSPIYMTF------DVAGLQVLEGKYVCNESSCRLDLSLQGAKSTGLYKCEVSGDAPHFKLAD 128

  Fly   132 VAADMEVVELPTQRPIITGIHSRYRLGDVINGNCSSDYSKPAANLTWWINDIQVPPNYLRIY-DI 195
            .|.:|.|..||...|:|...:|.||:.:.:...|.||:|.....|||:||..|  |....:| ..
  Fly   129 KADNMTVAALPQNDPLIESFNSMYRMEEYLKATCISDFSSLPTRLTWYINGEQ--PLLGELYPTT 191

  Fly   196 QRHVAEH---LESAVLEIKFVVTVHHFIKSR--LKLKCSARIHEIYAQESEKLIEEDRPRILASG 255
            ...:|.|   |....|:::|.:....|.::.  |:|||.|.|........||.:           
  Fly   192 DTSLAAHDYVLRRQRLQVQFFLQGQRFFQAGKILELKCVAEIENYPELRREKTL----------- 245

  Fly   256 RSPDMNMYPFDQPGDADEHNELFLIHSNAACG 287
             |..::.|.       :.:|::.|.|:||..|
  Fly   246 -SASLSQYD-------NFNNQMPLRHANANSG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IbNP_001162987.1 Ig 160..>182 CDD:299845 8/21 (38%)
beat-VaNP_001189214.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451075
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5491
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.