DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ib and CG5597

DIOPT Version :9

Sequence 1:NP_001162987.1 Gene:beat-Ib / 34939 FlyBaseID:FBgn0028645 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_611841.1 Gene:CG5597 / 37789 FlyBaseID:FBgn0034920 Length:260 Species:Drosophila melanogaster


Alignment Length:157 Identity:40/157 - (25%)
Similarity:69/157 - (43%) Gaps:20/157 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LLICNYDIENDTLY-TVKWYRGRREFYRYTPKENPAWKIFTKTNEIDVETAQSNA------SHVL 104
            :|.|:|::|....: ||||||..:..|::. ...|.:.|....|||| .|.:|:.      |.:.
  Fly    43 ILDCDYEVEESPKFITVKWYRDDKSIYQWI-FGTPPYAIPEFRNEID-STYESSTEPSKQYSSLA 105

  Fly   105 LRNVPTSISGKFACEVSADAPTFDTSIVAADMEVVELPTQRPIIT--GIHSRYRLGDVINGNCSS 167
            |.|...:.:|.:.|.|.....||.:.   ..::|::|......::  .||:..:|      ||:.
  Fly   106 LINPTIATTGDYKCVVQTSLNTFSSH---QRVQVIDLRNYTLELSHKTIHNETQL------NCTV 161

  Fly   168 DYSKPAANLTWWINDIQVPPNYLRIYD 194
            ....|...:|...||:.|......:|:
  Fly   162 TNVYPRPTITIISNDMDVVKREPMVYE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IbNP_001162987.1 Ig 160..>182 CDD:299845 4/21 (19%)
CG5597NP_611841.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451083
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.