DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ib and beat-IIIc

DIOPT Version :9

Sequence 1:NP_001162987.1 Gene:beat-Ib / 34939 FlyBaseID:FBgn0028645 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_724042.1 Gene:beat-IIIc / 35037 FlyBaseID:FBgn0032629 Length:383 Species:Drosophila melanogaster


Alignment Length:316 Identity:111/316 - (35%)
Similarity:161/316 - (50%) Gaps:36/316 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LFIITAI-YIASLPGLTV-GLRNVNVRIPSAVKRGDNALLICNYDIENDTLYTVKWYRGRREFYR 73
            |.::.|: :|.:|....| |||...||||..|.:|..|.|.|.||::.:.||:||||:...||||
  Fly     5 LSLLAALFFIGTLKDFRVAGLRLTEVRIPMYVIKGTAAQLECLYDLDGEALYSVKWYKDGNEFYR 69

  Fly    74 YTPKENPAWKIFTKTNEIDVETAQSNASHVLLRNVPTSISGKFACEVSADAPTFDTSIVAADMEV 138
            |.|::.|..:.|.... ::|:...|:.:.|.||||....:|:|.||||.:||:|.|.....||.|
  Fly    70 YVPRDMPPAQTFLLPG-VNVDLHNSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVTEHGDMIV 133

  Fly   139 VELPTQ-RPIITGIHSRYRLGDVINGNCSSDYSKPAANLTWWINDIQVPPNYLRIYDIQRHVAEH 202
            ..||.: .|.|:|...||::||.:..||::..||||..|:|.:|...|....||.||......:.
  Fly   134 AYLPDEGSPKISGGRPRYQIGDYVRVNCTAGRSKPAVKLSWQVNGEPVEQQKLRKYDTIVSGRDG 198

  Fly   203 LESAVLEIKFVVTVHHFIKSRLKLKCSARIHEIYAQESEKLIEEDRPR----------ILASGRS 257
            ||::||.::|.|...||.|..:||||.|.:..:|.:.:|:.:|.|||:          :.||...
  Fly   199 LETSVLGLQFRVEQKHFRKGNMKLKCIAELSTVYWRCNEESVEGDRPQKAPVLESRETVYASNSR 263

  Fly   258 PDMNMYPFDQPGDADEHNELFLIH------------SNAACGPFAWHPILFLLLWP 301
            .|        |.....:.|||:..            |:.|..|..  ||..|:|.|
  Fly   264 AD--------PVQGTSYRELFVTKILSLLFVQPNAASSTASAPST--PITPLVLLP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IbNP_001162987.1 Ig 160..>182 CDD:299845 8/21 (38%)
beat-IIIcNP_724042.1 IG_like 33..127 CDD:214653 39/94 (41%)
Ig 42..127 CDD:143165 36/85 (42%)
Ig 140..219 CDD:299845 30/78 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451089
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5491
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.