DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ib and beat-IIIb

DIOPT Version :9

Sequence 1:NP_001162987.1 Gene:beat-Ib / 34939 FlyBaseID:FBgn0028645 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_788071.3 Gene:beat-IIIb / 35031 FlyBaseID:FBgn0053179 Length:404 Species:Drosophila melanogaster


Alignment Length:252 Identity:91/252 - (36%)
Similarity:140/252 - (55%) Gaps:12/252 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PALKLRRLFIITAIYI-------ASLPGLTVGLRNVNVRIPSAVKRGDNALLICNYDIENDTLYT 61
            ||...|......|::|       .|:..||:    ..::||..:.|.::|:|.|.:|::.::||:
  Fly     3 PATNCRYSLAYGALFILLLQLCFESVECLTM----TEIKIPKHIMRHEDAVLGCKFDLDGESLYS 63

  Fly    62 VKWYRGRREFYRYTPKENPAWKIFTKTNEIDVETAQSNASHVLLRNVPTSISGKFACEVSADAPT 126
            ||||:...|||||.|::.|..::|.... :|||...|....|:||:|....:|::.||||.:||:
  Fly    64 VKWYKDGFEFYRYVPRDMPPGQVFPLPG-VDVELQNSTDVVVVLRSVSLQSTGRYRCEVSGEAPS 127

  Fly   127 FDTSIVAADMEVVELPTQRPIITGIHSRYRLGDVINGNCSSDYSKPAANLTWWINDIQVPPNYLR 191
            |.|.....||.||..|...|.|||...||::||::..||:|..|:|..:|:|.||.:....:.||
  Fly   128 FQTVSGHEDMIVVVTPKHGPQITGGQPRYQIGDMVRVNCTSAASRPVCHLSWLINGMHANRSLLR 192

  Fly   192 IYDIQRHVAEHLESAVLEIKFVVTVHHFIKSRLKLKCSARIHEIYAQESEKLIEEDR 248
            .|:......|.||.|.|.::|.|...||....:||||.|:|..:|.|.:|:.:|.|:
  Fly   193 PYEPLIVGREGLEVARLGLEFRVRGXHFKHGDMKLKCVAKISSVYWQSNEESVESDK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IbNP_001162987.1 Ig 160..>182 CDD:299845 8/21 (38%)
beat-IIIbNP_788071.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451088
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5491
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.