DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ib and f11r.2

DIOPT Version :10

Sequence 1:NP_523579.1 Gene:beat-Ib / 34939 FlyBaseID:FBgn0028645 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001076451.1 Gene:f11r.2 / 100005566 ZFINID:ZDB-GENE-060531-67 Length:294 Species:Danio rerio


Alignment Length:182 Identity:41/182 - (22%)
Similarity:74/182 - (40%) Gaps:24/182 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IITAIYIA---SLPGLTVGLRNVNVRIPSA-VKRGDNALLICNYDIENDTLYTVKW-YRGRREFY 72
            ::|.:::.   ||.||.... :|.|..|.. ||..:...|.|:|..:......|:| :|..:.|.
Zfish     1 MLTLVFVCLSFSLTGLHASF-SVAVNGPIVKVKENEGVDLQCSYTADFGATPRVEWKFRNLKGFQ 64

  Fly    73 RYTPKENPAWKIFTKTNEIDVETAQS---NASHVLLRNVPTSISGKFACEVSADAPTFDTSIVAA 134
            .:         |:. .|:..||..|.   .|..:..:.|..:.:|.:.||||.:....:.:|.. 
Zfish    65 YF---------IYF-NNKPTVEYEQRITVYAGGLRFQKVTRADAGDYNCEVSGNGGYGENTIKL- 118

  Fly   135 DMEVVELPTQRPIITGIHSRYRLGDVINGNCSSDYSKPAANLTWWINDIQVP 186
               ||.:|..:| ::.|.|....|..:...|......|.:...|:.::..:|
Zfish   119 ---VVSVPPSKP-VSSIPSSVTTGSNVRLTCFDPVGSPPSTYEWYKDNNLLP 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IbNP_523579.1 Ig 144..>182 CDD:472250 7/37 (19%)
Ig strand B 161..165 CDD:409353 0/3 (0%)
Ig strand C 175..179 CDD:409353 0/3 (0%)
f11r.2NP_001076451.1 Ig 21..120 CDD:472250 25/112 (22%)
Ig strand B 37..41 CDD:409353 1/3 (33%)
Ig strand C 52..56 CDD:409353 1/3 (33%)
Ig strand E 86..90 CDD:409353 0/3 (0%)
Ig strand F 100..105 CDD:409353 1/4 (25%)
Ig strand G 113..116 CDD:409353 0/2 (0%)
Ig 127..223 CDD:472250 8/41 (20%)
Ig strand B 141..145 CDD:409353 0/3 (0%)
Ig strand C 155..159 CDD:409353 0/3 (0%)
Ig strand E 187..191 CDD:409353
Ig strand F 201..206 CDD:409353
Ig strand G 216..219 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.