DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31821 and PRC1

DIOPT Version :9

Sequence 1:NP_001285968.1 Gene:CG31821 / 34938 FlyBaseID:FBgn0051821 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_014026.1 Gene:PRC1 / 855343 SGDID:S000004912 Length:532 Species:Saccharomyces cerevisiae


Alignment Length:451 Identity:109/451 - (24%)
Similarity:169/451 - (37%) Gaps:120/451 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GFGPG-EQDWGYVDVRD-GAHMFYWLYYTTANVSSYTDRPLVLWLQGGPGGSSTALGNFQELGPV 85
            |..|. .|..||:||.| ..|.|:|.:.:..:.:.   .|::|||.||||.||.. |.|.||||.
Yeast   120 GIDPNVTQYTGYLDVEDEDKHFFFWTFESRNDPAK---DPVILWLNGGPGCSSLT-GLFFELGPS 180

  Fly    86 DTN------GQPRDGNWVQYVNVLFIDNPVGSGFSYADNTSLLVTNNEELIDDLISFMLHFYKLH 144
            ...      |.|.  :|.....|:|:|.||..||||:.::.  |:|......|:.:|:..|:...
Yeast   181 SIGPDLKPIGNPY--SWNSNATVIFLDQPVNVGFSYSGSSG--VSNTVAAGKDVYNFLELFFDQF 241

  Fly   145 KEF--KNVPLHIFSESYGGKMAPALAIRLAKAMSAGELAHPG---TLKSVTIGNPWISTRHISRE 204
            .|:  |....||..|||.|...|..|..:        |:|..   .|.||.|||      .::..
Yeast   242 PEYVNKGQDFHIAGESYAGHYIPVFASEI--------LSHKDRNFNLTSVLIGN------GLTDP 292

  Fly   205 HSKYLFVNGLIDEDG--VALLDAQE--------ERILSALKKHEFDKATDEYLRW---------- 249
            .::|.:...:...:|  .::|.::|        ||.|..:     :...|....|          
Yeast   293 LTQYNYYEPMACGEGGEPSVLPSEECSAMEDSLERCLGLI-----ESCYDSQSVWSCVPATIYCN 352

  Fly   250 --------------YELMQQLTGEIYLYNTQTHVDPSEDRTYGYGEEFIRFIERNVSEALQINGT 300
                          |::.:...|....|.|...:|...::.|             |.||:.....
Yeast   353 NAQLAPYQRTGRNVYDIRKDCEGGNLCYPTLQDIDDYLNQDY-------------VKEAVGAEVD 404

  Fly   301 VYASQVMEVLSS--LHGDRLKSEINTIPRLLNETSVKVNIYSGQLDTLVPTTATLALIKDW---- 359
            .|.|...::..:  ..||.:|.....:..|||: .:.:.:|:|..|          .|.:|    
Yeast   405 HYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQ-DLPILVYAGDKD----------FICNWLGNK 458

  Fly   360 AWND------KSEYLE---ANRTTIV---IKGILQGYKKVGGNFGMYWINRSGHMAPSDNP 408
            ||.|      ..|:..   .|.|..:   :.|.::.||    :|....:...|||.|.|.|
Yeast   459 AWTDVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYK----HFTYLRVFNGGHMVPFDVP 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31821NP_001285968.1 Peptidase_S10 26..417 CDD:298660 108/448 (24%)
PRC1NP_014026.1 Kex1 25..528 CDD:225490 109/451 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54069
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9182
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.