DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31821 and CTSA

DIOPT Version :9

Sequence 1:NP_001285968.1 Gene:CG31821 / 34938 FlyBaseID:FBgn0051821 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001161066.1 Gene:CTSA / 5476 HGNCID:9251 Length:481 Species:Homo sapiens


Alignment Length:476 Identity:110/476 - (23%)
Similarity:184/476 - (38%) Gaps:106/476 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LSIVCLIFLFGISEARKGFGPGEQD-----------------WGYVDVRDGAHMFYWLYYTTANV 53
            |.::.|:.|..:|.|.:|....:||                 .||:......|:.||.      |
Human    27 LFLLLLLLLLLVSWASRGEAAPDQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWF------V 85

  Fly    54 SSYTD---RPLVLWLQGGPGGSSTALGNFQELGPVDTNGQPRDGNWVQYVNVLFIDNPVGSGFSY 115
            .|..|   .|:||||.||||.||.. |...|.||            ....|||::::|.|.||||
Human    86 ESQKDPENSPVVLWLNGGPGCSSLD-GLLTEHGP------------FLIANVLYLESPAGVGFSY 137

  Fly   116 ADNTSLLVTNNEELIDDLISFMLHFYKLHKEFKNVPLHIFSESYGGKMAPALAIRLAKAMSAGEL 180
            :|: ....||:.|:.......:..|::|..|:||..|.:..|||.|...|.||:.:.:..|.   
Human   138 SDD-KFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSM--- 198

  Fly   181 AHPGTLKSVTIGNPWISTRHISREHSKYLFVNGLIDEDGVALLDAQEERILSALKKHEFDKATDE 245
                .|:.:.:||...|..........:.:.:||:   |..|..:.:....|..|.:.:|....|
Human   199 ----NLQGLAVGNGLSSYEQNDNSLVYFAYYHGLL---GNRLWSSLQTHCCSQNKCNFYDNKDLE 256

  Fly   246 YLRWYELMQQLTGE--IYLYN--------TQTHVDPSEDR--TYGYGEEFIRF-IERNVSEALQI 297
            .:...:.:.::.|.  :.:||        ..:|....:|.  ....|..|.|. ::|...:||..
Human   257 CVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLR 321

  Fly   298 NG-----------TVYAS---------------------QVMEVLSSLHGDRLKSEINT-IPRLL 329
            :|           |..||                     .:...|.:|...||...:|: ..:||
Human   322 SGDKVRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLL 386

  Fly   330 NETSVKVNIYSGQLDTLVPTTATLALIKDWAWNDKSEYLEANRTTIVIK-----GILQGYKKVGG 389
            :....::.:|:|.:|     .|...:..:|..:..::.:|..|...::|     ..:.|:.|...
Human   387 SSQKYQILLYNGDVD-----MACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFS 446

  Fly   390 NFGMYWINRSGHMAPSDNPVA 410
            :.....|..:|||.|:|.|:|
Human   447 HIAFLTIKGAGHMVPTDKPLA 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31821NP_001285968.1 Peptidase_S10 26..417 CDD:298660 104/456 (23%)
CTSANP_001161066.1 Peptidase_S10 57..477 CDD:278857 102/446 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2160
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.