DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31821 and Cpvl

DIOPT Version :9

Sequence 1:NP_001285968.1 Gene:CG31821 / 34938 FlyBaseID:FBgn0051821 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_006236573.2 Gene:Cpvl / 502774 RGDID:1563609 Length:484 Species:Rattus norvegicus


Alignment Length:416 Identity:124/416 - (29%)
Similarity:187/416 - (44%) Gaps:58/416 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PGEQD---WGYVDVRD--GAHMFYWLYYTTANVSSYTDRPLVLWLQGGPGGSSTALGNFQELGP- 84
            ||..|   .||:.|..  .:::|:|.:......:   |.|:|||||||||||| ..|.|.|.|| 
  Rat    75 PGMYDKSYAGYITVNQTYNSNLFFWFFPARTQPA---DAPVVLWLQGGPGGSS-MFGLFVEHGPY 135

  Fly    85 VDTNGQ---PRDGNWVQYVNVLFIDNPVGSGFSYADNTSLLVTNNEELIDDLISFMLHFYKLHKE 146
            :.|:..   .||..|...:::|:||||||:|||:.|:......:.:::..||.|.::.|:||..|
  Rat   136 IITSNMTVLSRDFPWTFSLSMLYIDNPVGTGFSFTDHIQGYAIDEDDVAQDLYSALVQFFKLFPE 200

  Fly   147 FKNVPLHIFSESYGGKMAPALA--------IRLAKAMSAGELAHPGTLKSVTIGNPWISTRHISR 203
            :.....:|..|||.||..||:|        :|..|.          .||.:.:|:.:.....|..
  Rat   201 YAKNDFYITGESYAGKYVPAIAYYIHSLNPVRRFKI----------RLKGIALGDAYTDPETIIG 255

  Fly   204 EHSKYLFVNGLIDEDGVALLDAQEERILSALKKHEFDKA---TDEYL-----RWYELMQQLTGEI 260
            .::.:|:..||:||........|..:.:..:|:.|:.||   .||.|     ......|.:||..
  Rat   256 GYATFLYEVGLLDEQQRRHFRKQCRKCIKYIKEQEWMKAFEVLDELLDGDLTAGPSFFQNVTGCT 320

  Fly   261 YLYNTQTHVDPSEDRTYGYGEEFIRFIE-RNVSEALQINGTVYASQVMEVLSSLHGDRLKSEINT 324
            ..||.....:| ||::|     |.:|:. ..|.:|:.: |....|...||...|..|.:||....
  Rat   321 NYYNILQCTEP-EDQSY-----FSKFLSLPQVRQAIHV-GNRNFSDGAEVEKYLREDTVKSVKPW 378

  Fly   325 IPRLLNETSVKVNIYSGQLDTLVPTTATLALIKDWAWNDKSEYLEANRTTIVIKGILQ------G 383
            :..::|  ..||.||:||||.:|....|...:....|.....|   .||...|..|.:      |
  Rat   379 LAEIMN--YYKVLIYNGQLDIIVAAALTERSLMTMDWKGSYAY---RRTHKKIWKIFESDDEVAG 438

  Fly   384 YKKVGGNFGMYWINRSGHMAPSDNPV 409
            |.:..|.|....:...||:.|.|.|:
  Rat   439 YVRRVGKFHQVIVRGGGHILPYDQPL 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31821NP_001285968.1 Peptidase_S10 26..417 CDD:298660 124/416 (30%)
CpvlXP_006236573.2 Kex1 48..478 CDD:225490 124/416 (30%)
Peptidase_S10 80..474 CDD:278857 121/411 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54069
OrthoDB 1 1.010 - - D274674at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.