DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31821 and cpy1

DIOPT Version :9

Sequence 1:NP_001285968.1 Gene:CG31821 / 34938 FlyBaseID:FBgn0051821 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_594425.1 Gene:cpy1 / 2542465 PomBaseID:SPAC19G12.10c Length:1002 Species:Schizosaccharomyces pombe


Alignment Length:451 Identity:113/451 - (25%)
Similarity:172/451 - (38%) Gaps:94/451 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GFGPGEQDWGYVDVRDGAHMFYWLYYTTANVSSYTDRPLVLWLQGGPGGSSTALGNFQELGPVDT 87
            |....:|..||:||.|..|:|:|.:.:.   :...:.|:||||.||||.||.. |.|.||||...
pombe   582 GIDTVKQYTGYLDVEDDRHLFFWFFESR---NDPENDPVVLWLNGGPGCSSLT-GLFMELGPSSI 642

  Fly    88 N-----GQPRDGNWVQYVNVLFIDNPVGSGFSYADNTSL-LVTNNEELIDDLISFMLHFYKLHKE 146
            |     .:....:|....:|:|:|.|:.:|||..|::.| .||..:    |:.:|:..|:....:
pombe   643 NIETLKPEYNPHSWNSNASVIFLDQPINTGFSNGDDSVLDTVTAGK----DVYAFLNLFFAKFPQ 703

  Fly   147 FKNVPLHIFSESYGGKMAPALAIRLAK-AMSAGELAHPG--------TLKSVTIGN----PWIST 198
            :.::..||..|||.|...|..|..:.: ...|......|        .||||.|||    |.:  
pombe   704 YAHLDFHIAGESYAGHYIPQFAKEIMEHNQGANFFVASGYEMEKQYINLKSVLIGNGLTDPLV-- 766

  Fly   199 RHISREHSKYLFVNGLIDEDGVALLDAQEERILSALKKHEFDKATDEYLRWYELMQQLTG----- 258
                    :|.|...:..|.....:.:||          |.|:.|..|....:|   :||     
pombe   767 --------QYYFYGKMACESPYGPIMSQE----------ECDRITGAYDTCAKL---ITGCYQTG 810

  Fly   259 --------EIYLYN------TQTHVDPSEDRTYGYGEEFIRFIERNVSEALQINGTVYASQ--VM 307
                    .:|..|      |:|.::..:.|.....:|.:.:.|....|:       |.:|  |.
pombe   811 FTPVCIGASLYCNNAMIGPFTKTGLNIYDIREECRDQEHLCYPETGAIES-------YLNQEFVQ 868

  Fly   308 EVLS----------------SLHGDRLKSEINTIPRLLNETSVKVNIYSGQLDTLVPTTATLALI 356
            |.|.                ...||.::.........:.|..:.|.||:|..|.:.......|..
pombe   869 EALGVEYDYKGCNTEVNIGFLFKGDWMRKTFRDDVTAILEAGLPVLIYAGDADYICNYMGNEAWT 933

  Fly   357 KDWAWNDKSEYLEANRTTIVIKGILQGYKKVGGNFGMYWINRSGHMAPSDNPVAMQYVLQS 417
            ....|..:.|:.||........|...|..|...|||...:..:|||.|.:.|.|...:|.|
pombe   934 DALEWAGQREFYEAELKPWSPNGKEAGRGKSFKNFGYLRLYEAGHMVPFNQPEASLEMLNS 994

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31821NP_001285968.1 Peptidase_S10 26..417 CDD:298660 111/446 (25%)
cpy1NP_594425.1 DUF4779 344..>419 CDD:292628
Kex1 540..998 CDD:225490 113/451 (25%)
Peptidase_S10 578..998 CDD:278857 113/451 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2939
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9280
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.