DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tep1 and AI182371

DIOPT Version :9

Sequence 1:NP_523578.1 Gene:Tep1 / 34937 FlyBaseID:FBgn0041183 Length:1354 Species:Drosophila melanogaster
Sequence 2:XP_017174840.1 Gene:AI182371 / 98870 MGIID:2138853 Length:366 Species:Mus musculus


Alignment Length:222 Identity:53/222 - (23%)
Similarity:87/222 - (39%) Gaps:40/222 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TILHCVLLSNANG----LYSVLAPKTLRSNSAYNVVVAIHNTTRTTEVSVSLTG-PSLNSRKYVD 68
            |:|..:.|..:.|    .|.:..|...|..:..||.|..|..|...:.:||:.. |..|.|....
Mouse    24 TLLFLIFLEQSWGQEQTRYIISTPIVFRVGAPENVTVQAHGHTEAFDTTVSVKSYPDENVRYSFS 88

  Fly    69 VQSMSSKSVRFDIPKLTEGDYELKVMGSGGIEFQNS---------TKLSFAP---DLNWLYIQSD 121
            ..::|.::...:...||   .:.|.:..|...|.||         .||...|   |.:.|::|:|
Mouse    89 TVNLSPENKFQNTAILT---IQAKQLSEGQNSFSNSYLEVVSKHFAKLEIVPIIYDNDSLFVQTD 150

  Fly   122 KATYKPGDKIQFRVLFLDKNTRPAVIDKPIKIEIRDGDQ-------NL--IKSWKDIKPAKGVYS 177
            |:.|.|...::.||..::.:..||..:..:.....:|.|       ||  |.|:.|         
Mouse   151 KSVYTPQQPVKVRVYSVNDDLEPATRETVLTFIDPEGSQVDTIEGNNLTGIASFPD--------- 206

  Fly   178 GELQLSDRPVLGNWTVTATVQDEGKVT 204
              .::...|..|.|||.|..:::...|
Mouse   207 --FEIPSNPKHGRWTVKAKYREDASKT 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tep1NP_523578.1 A2M_N 116..201 CDD:280081 23/93 (25%)
A2M_N_2 411..542 CDD:285005
A2M 634..726 CDD:278630
A2M_2 859..1135 CDD:239227
A2M_comp 910..1135 CDD:284982
A2M_recep 1245..1335 CDD:284981
AI182371XP_017174840.1 MG1 42..138 CDD:375333 23/98 (23%)
A2M_N 145..238 CDD:376626 24/98 (24%)
ANATO 279..347 CDD:237984
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839999
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.