DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tep1 and LOC108644460

DIOPT Version :9

Sequence 1:NP_523578.1 Gene:Tep1 / 34937 FlyBaseID:FBgn0041183 Length:1354 Species:Drosophila melanogaster
Sequence 2:XP_031761281.1 Gene:LOC108644460 / 108644460 -ID:- Length:119 Species:Xenopus tropicalis


Alignment Length:62 Identity:20/62 - (32%)
Similarity:30/62 - (48%) Gaps:3/62 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly  1274 VKRVETKNEDTEVHIYFEKLSPGDRKCLTLEAIYTHAVANLKPSWVRLYDYYATERSATEFY 1335
            :.|.|.||  ..|.:|...:|....: |.|:....:.|.|:.||.|..||||.|:::....|
 Frog    53 ISRYELKN--NHVFLYLSSVSSKTVE-LPLKMEMGNRVLNVAPSSVYAYDYYDTDQNGYAAY 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tep1NP_523578.1 A2M_N 116..201 CDD:280081
A2M_N_2 411..542 CDD:285005
A2M 634..726 CDD:278630
A2M_2 859..1135 CDD:239227
A2M_comp 910..1135 CDD:284982
A2M_recep 1245..1335 CDD:284981 19/60 (32%)
LOC108644460XP_031761281.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D354230at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.