DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Tep1 and LOC101886227

DIOPT Version :9

Sequence 1:	NP_523578.1	Gene:	Tep1 / 34937	FlyBaseID:	FBgn0041183	Length:	1354	Species:	Drosophila melanogaster
Sequence 2:	XP_021322237.1	Gene:	LOC101886227 / 101886227	-ID:	-	Length:	140	Species:	Danio rerio

Alignment Length:	139	Identity:	33/139 - (23%)
Similarity:	53/139 - (38%)	Gaps:	39/139 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 SSTILHCVLLSNANGLYSVLAPKTLRS-NSAYNVVVAIHNTTRTTEVSVSLTGPSLNSRKYVDVQ 70
            :.|:...:.|.::|....:|..|..:. :..:|....:.......::.|.|.|.|.|
Zfish    24 NKTLFMNIYLVHSNQSTLLLQEKAEQEFHRCFNFQAPLAEAESVQKIKVELQGESFN-------- 80

  Fly    71 SMSSKSVRFDIPKLTEGDYELKVMGSGGIEFQNSTKLSFAPDLNWLYIQSDKATYKPGDKIQFRV 135
                         :||   |.|||      |::...|:|        ||.||..|..|..:.|||
Zfish    81 -------------MTE---ERKVM------FKSYHPLTF--------IQMDKPFYIAGQTVNFRV 115

  Fly   136 LFLDKNTRP 144
            :.:||:.||
Zfish   116 VTMDKSFRP 124

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Tep1	NP_523578.1	A2M_N	116..201	CDD:280081	13/29 (45%)
		A2M_N_2	411..542	CDD:285005
		A2M	634..726	CDD:278630
		A2M_2	859..1135	CDD:239227
		A2M_comp	910..1135	CDD:284982
		A2M_recep	1245..1335	CDD:284981
LOC101886227	XP_021322237.1	A2M_N	96..>135	CDD:327702	14/37 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D177369at33208
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.010