DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tektin-A and Tekt5

DIOPT Version :9

Sequence 1:NP_001260476.1 Gene:Tektin-A / 34934 FlyBaseID:FBgn0028902 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001277930.1 Gene:Tekt5 / 70426 MGIID:1917676 Length:557 Species:Mus musculus


Alignment Length:515 Identity:137/515 - (26%)
Similarity:225/515 - (43%) Gaps:58/515 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LQADLQAG---VDQQQMQLADMRAEQYKQSNKPLRMEEVQFARSMDPEADDLRNPPCYLPQQGDE 143
            |||...||   |.|:..|...:...:|..:.:|....::..::::..|...:|.||..||.....
Mouse    21 LQALPPAGQEPVVQECYQPFHLPGYRYLNAWRPSVFHKIATSQTIPEECSGIRRPPTILPSLRSA 85

  Fly   144 LPHKDQLMPMGPIGPWASGKVDWSPMAGITGTRPVVDRYSITRYSPNEWRTRNHETVQVVNASLG 208
            |                                       ..||:|.:|...|  .:|:.||...
Mouse    86 L---------------------------------------FCRYTPRDWDRSN--DLQIRNAEAS 109

  Fly   209 RADKNRFSSTTEFLRL----SALVDKSQKETTDKLRIRSQLIGKWKNTLENAIKAMADEISTMEV 269
            |...:|.  |.:.||:    ..|:.:.|:.|:..|..|...:|.||:.|...:..:..|.|:|:.
Mouse   110 RLWASRL--TGDSLRIMQDKDQLIHQMQEGTSRNLGQRLSDLGFWKSELCYELDRLLTENSSMDT 172

  Fly   270 ERIKLRKSMVVLGVPESIAKECIEKRATRPDTELVRDQVEEELVNELALIA----EIRRLLMKTL 330
            .:.:|..:...:..|..:|.||:..|..|...:||.|.||:.|:.|:.|:.    ::|:|..:. 
Mouse   173 LKRRLECAAEEVNCPLQVALECLYNREKRIGIDLVHDNVEKNLIREVDLLKCCQDQMRKLAKRI- 236

  Fly   331 DDFNSQQVENRTARQRLEYDWSDKKESYEIDTINTGLNNCSRTIMFRPGAVRQPPEQASEKYWEH 395
             ||  |..:||.|:..||.|..||..:..||.....|.:.|.:|.|..|..:.....:..:.|..
Mouse   237 -DF--QIRDNRDAQHSLERDIEDKSSAQYIDENCFNLRSTSDSISFFHGVEKFDGTVSIPETWAK 298

  Fly   396 FSMETLDECEKCRLKSVALRNTLNSTLMNAARDIRTQADVVEKALTSRINCTQEAVQRFENDLKN 460
            ||.:.:...:..|..|:.||..........:..:..|......|..:||:...:...:.:..|..
Mouse   299 FSNDNIRHAQNMRANSIRLREEAEHLFETLSDQMWKQFTNTNLAFNARISEETDVKNKLQTQLAK 363

  Fly   461 ILQGTADVENRIEQMKRRINSFDSSMKVAQTRMDNRSYRPNVENCRDLAQQELIDGVHTIQSSVS 525
            |||.....||.|..::|.|.:.:..:|:|||.:..|:.|||||.|||:.|..|::.|.||..::.
Mouse   364 ILQEIFQAENTIMLLERAIVAKEYPLKMAQTMLACRTRRPNVELCRDVPQFRLVNEVFTIDDTLQ 428

  Fly   526 ALLHELEEAERVKTDLVNSRARLEREIMLKRRSLFIDRERCMLMRSYYPSANTLSGAATS 585
            .|...|.|.:.....||.:::|||.|:.:|..:|.||:::||.||..:||...|:|...|
Mouse   429 TLKLRLRETQDTLQLLVMTKSRLEHELAIKANTLCIDKDKCMSMRKSFPSTPRLTGYTCS 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tektin-ANP_001260476.1 Tektin 192..571 CDD:281184 111/386 (29%)
Tekt5NP_001277930.1 Tektin 95..474 CDD:281184 111/386 (29%)
6 X 6 AA approximate tandem repeats of C-[GSK]-G-[GSPH]-A-[SLP]. /evidence=ECO:0000305 507..541
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59762
OrthoDB 1 1.010 - - D264325at33208
OrthoFinder 1 1.000 - - FOG0000711
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.