DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tektin-A and TEKT2

DIOPT Version :9

Sequence 1:NP_001260476.1 Gene:Tektin-A / 34934 FlyBaseID:FBgn0028902 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_055281.2 Gene:TEKT2 / 27285 HGNCID:11725 Length:430 Species:Homo sapiens


Alignment Length:410 Identity:103/410 - (25%)
Similarity:184/410 - (44%) Gaps:13/410 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 RYSPNEWRTRNHETVQVVNASLGRADKNRFSSTTEFLRLSALVDKSQKETTDKLRI--RSQLIGK 248
            |:...:|.|.::  :...||.|.|...::.......||..........|..::.|:  |...:.:
Human    11 RFQLPDWHTNSY--LLSTNAQLQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLVERIDTVNR 73

  Fly   249 WKNTLENAIKAMADEISTMEVERIKLRKSMVVLGVPESIAKECIEKRATRPDTELVRDQVEEELV 313
            ||..|:..:..:..||..:...:....:::....:|..:|.||:..|.:|.|.::|:|.||:||.
Human    74 WKEMLDKCLTDLDAEIDALTQMKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVKDPVEDELH 138

  Fly   314 NELALIAEIRRLLMKTLDDFNSQQVENRTARQRLEYDWSDKKESYEIDTINTGLNNCSRTIMFRP 378
            .|:.:|...::.|.:.:.....|....:..:|:|..|...|.|:.|||.....||..|..|..:.
Human   139 KEVEVIEATKKALQQKVSQAFEQLCLLQEVQQQLNSDHRGKMETLEIDRGCLSLNLRSPNISLKV 203

  Fly   379 GAVRQPPEQASEKYWEHFSMETLDECEKCRLKSVALRNTLNSTLMNAARDIRTQADVVEKALTSR 443
            ...|.|....:.:.|:.||....|..|.....:..||.....|:.....::..|....|.|...|
Human   204 DPTRVPDGSTTLQQWDDFSRFNKDRAEAEMKAATELREATALTIAETNNELEAQRVATEFAFRKR 268

  Fly   444 INCTQEAVQRFENDLKNILQGTADVENRIEQMKRRINSFDSSMKVAQTRMDNRSYRPNVENCRDL 508
            :...::.....:...||.|:..|:::..|..::..:.:...|:|::.||::.|:||||||.|||.
Human   269 LREMEKVYSELKWQEKNTLEEIAELQEDIRHLEEDLRTKLLSLKLSHTRLEARTYRPNVELCRDQ 333

  Fly   509 AQQELIDGVHTIQSSVSALLHELEEAERVKTDLVNSRARLEREIMLKRRSLFIDRERCMLMR--- 570
            ||..|.|.||.::::::||..:|.:|:.....|....|||:.:|..|..|:.:| .:||..|   
Human   334 AQYGLTDEVHQLEATIAALKQKLAQAQDALDALCKHLARLQADIACKANSMLLD-TKCMDTRRKL 397

  Fly   571 -----SYYPSANTLSGAATS 585
                 .:.|..:|.:....|
Human   398 TVPAERFVPEVDTFTRTTNS 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tektin-ANP_001260476.1 Tektin 192..571 CDD:281184 99/388 (26%)
TEKT2NP_055281.2 Tektin 17..395 CDD:308655 98/380 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2685
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59762
OrthoDB 1 1.010 - - D264325at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.