DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tektin-A and TEKT4

DIOPT Version :9

Sequence 1:NP_001260476.1 Gene:Tektin-A / 34934 FlyBaseID:FBgn0028902 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_011508972.1 Gene:TEKT4 / 150483 HGNCID:31012 Length:476 Species:Homo sapiens


Alignment Length:490 Identity:131/490 - (26%)
Similarity:218/490 - (44%) Gaps:62/490 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 PPCYLPQQGDELPHKDQLMPMGPIGPWASGKVDWSPMAGITGTRPVVDRYSITRYSPNEWRTRNH 197
            |||       |||.|:..:........:||....|              :..::|...||....:
Human     6 PPC-------ELPCKEYDVARNTGAYTSSGLATAS--------------FRTSKYLLEEWFQNCY 49

  Fly   198 ETVQVVNASLGRADKNRFSSTTEFLRLSALVDKSQKETTDKLRIRSQLIGKWKNTLENAIKAMAD 262
            .......|...::::.|..|........||..::|:::|..:..|.|....||:.|:..::|:|.
Human    50 ARYHQAFADRDQSERQRHESQQLATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAA 114

  Fly   263 EISTMEVERIKLRKSMVVLGVPESIAKECIEKRATRPDTELVRDQVEEELVNELALIAEIRRLLM 327
            |.:.:..::.:|.:::....||.||..:.::.|..|....||||.||.||:.|..||..|:.||.
Human   115 ETNLLLAQKQRLERALDATEVPFSITTDNLQCRERREHPNLVRDHVETELLKEAELIRNIQELLK 179

  Fly   328 KTLDDFNSQQVENRTARQRLEYDWSDKKESYEIDTINTGLNNCSRTIMFRPGAVRQPPEQASEKY 392
            :|:....||...||..::..|.|||||.|:|.||......::.|..:...|.:.......::.:.
Human   180 RTIMQAVSQIRLNREHKETCEMDWSDKMEAYNIDETCGRHHSQSTEVQAHPYSTTFQESASTPET 244

  Fly   393 WEHFSMETLDECEKCRLKSVALRNTLNSTLMNAARDIRTQADVVEKALTSRINCTQEAVQRFEND 457
            ...|:.:.|...::.||.|..||..::..|.:.:.|:|.|.|.|..|...|....::|..:..:.
Human   245 RAKFTQDNLCRAQRERLASANLRVLVDCILRDTSEDLRLQCDAVNLAFGRRCEELEDARYKLHHH 309

  Fly   458 L------------------------KNILQG-----------------TADVENRIEQMKRRINS 481
            |                        ::|..|                 ..|.|:.:..:|:.|..
Human   310 LHKGHWSGLPSGHSPKTWVGPAWSRRSIYPGMGAQAQGELSCLQTLREITDQEHNVAALKQAIKD 374

  Fly   482 FDSSMKVAQTRMDNRSYRPNVENCRDLAQQELIDGVHTIQSSVSALLHELEEAERVKTDLVNSRA 546
            .::.:.|||||:..||:|||:|.|||.||..|:..|..:..|::||..:|.|||:...:|.:...
Human   375 KEAPLHVAQTRLYLRSHRPNMELCRDAAQFRLLSEVEELNMSLTALREKLLEAEQSLRNLEDIHM 439

  Fly   547 RLEREIMLKRRSLFIDRERCMLMRSYYPSANTLSG 581
            .||::|.....||||||::||..|:.||:...|:|
Human   440 SLEKDIAAMTNSLFIDRQKCMAHRTRYPTILQLAG 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tektin-ANP_001260476.1 Tektin 192..571 CDD:281184 114/419 (27%)
TEKT4XP_011508972.1 Tektin 44..464 CDD:281184 114/419 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2685
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59762
OrthoDB 1 1.010 - - D264325at33208
OrthoFinder 1 1.000 - - FOG0000711
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108956
Panther 1 1.100 - - LDO PTHR19960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.