DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13243 and catip

DIOPT Version :9

Sequence 1:NP_001260475.1 Gene:CG13243 / 34933 FlyBaseID:FBgn0028903 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001070238.1 Gene:catip / 767803 ZFINID:ZDB-GENE-060929-1170 Length:356 Species:Danio rerio


Alignment Length:337 Identity:69/337 - (20%)
Similarity:134/337 - (39%) Gaps:75/337 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 ERELEQ----------------IGRFCLNV-EESFDG---YVIFSSSKMKKGKGMTE---CGHQL 156
            :|:|||                :|.|.::| :.|::.   |::.::|     .|..:   ||..:
Zfish    28 QRDLEQCLFADSLVTVSDSGRELGDFSVSVTKASYNEELCYLLHANS-----HGTIDDVPCGTSI 87

  Fly   157 KGKYDDKFLLICEKRSEFDRIDNTRVEKTLEL-RNHADLMLTAIRETKINEEVQRFKARIDIKDR 220
            ......|..::.|...|:.:::...|::.:.: |....|::..:...:...:.|..|..:...|.
Zfish    88 VAYISRKLEILEENHHEYVKLEKKTVDRKIHIVRQDDQLVVDRVISEREGVKTQTLKFPLSSLDG 152

  Fly   221 DHVFVLDGGIMLLMRHLVCNNFV-GNFEYYTM--------NLYGRVLRCNLVVSKERKEVRIFYR 276
               ||.:....||:|.:.....| .|..:.::        ::|..:.....:|.::..::....|
Zfish   153 ---FVSEASNFLLLRIMARQKIVPENMTFLSLDADSGLSKSVYKALGWQKQMVGEDLVDIFGIER 214

  Fly   277 T-YKNVVHIFTQQCFNDELQDVAETFMTPEGRIVLHYWRGYNYLLHAACMP-------------- 326
            | |...:...|..||          || |:|.:......|...::....:|              
Zfish   215 TIYSANLSSATWHCF----------FM-PDGHLASRVQLGSPAVMKLLHLPFLLDGVIKTFFFLV 268

  Fly   327 PKRKEPILPKLELMWRQNEQLSRKF----RELKALNYENATSYLSSNSQLADFMQDYVLNLLRYK 387
            .|.|.|::.|..|:|.::.:|..||    .||||    :.:|||..:.:|...:.|::..||..|
Zfish   269 EKDKIPVMEKKPLIWEEDMELYSKFLDRKEELKA----DYSSYLRQHPELKALLADFLQFLLLRK 329

  Fly   388 PSNVLEFSIMFF 399
            |.:|..|:..||
Zfish   330 PQDVFSFARDFF 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13243NP_001260475.1 DD_R_PKA 371..404 CDD:295380 10/29 (34%)
catipNP_001070238.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28H6N
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007943
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.