DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13243 and CATIP

DIOPT Version :9

Sequence 1:NP_001260475.1 Gene:CG13243 / 34933 FlyBaseID:FBgn0028903 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001307794.1 Gene:CATIP / 375307 HGNCID:25062 Length:398 Species:Homo sapiens


Alignment Length:366 Identity:82/366 - (22%)
Similarity:135/366 - (36%) Gaps:110/366 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 FISKLRNTNCKLNENLKIFFEREL-----------------------EQIG--RFCLNVEESFDG 134
            |:|.|.....::     :||...|                       |::|  .:||.|..|..|
Human    46 FLSSLHKEELQM-----LFFSETLAMVSDTGEPQGELTIEVQRGKYQEKLGMLTYCLFVHASSRG 105

  Fly   135 YVIFSSSKMKKGKGMTECGHQLKGKYDDKFLLICEKRSEFDRIDNTRVEKTLELRNHADLMLTAI 199
            ::    .||.       ||:.|.|...:|..|:.:...:|.:.....:|:.:.|....| .|...
Human   106 FL----DKML-------CGNSLLGYLSEKLELMEQHSQDFIKFLILPMERKMSLLKQDD-QLAVT 158

  Fly   200 RETKINEEVQRFKARI---DIKDRDHVFVLDGGIMLLMRHLVCNNFV-GNFEYYTMNLYGRVLRC 260
            |..|..|||:......   .||.    |:.:...::|:|.:.....| .|..:.|::..|::  |
Human   159 RSIKEGEEVKTGVTSFPWSSIKG----FISEAANLVLLRVMAWRRMVPSNARFLTLDTEGKL--C 217

  Fly   261 NLVVSKERKEVRIFYRTYKNV----VHIFTQQCFNDELQDVAETFMTPEGRIVLHYWRG-----Y 316
                          |.||:|:    :.:..||         ||.|:..:   .:|...|     .
Human   218 --------------YLTYQNLGFQTIQVDHQQ---------AEVFIVEQ---TVHAEEGIPMSCQ 256

  Fly   317 NYLL---HAA----------C----MPPKRKE------PILPKLELMWRQNEQLSRKFRELKALN 358
            .|||   |.|          |    ||..|:|      |:..|..|:|.::.:|..||.:.|...
Human   257 YYLLSDGHLAKRIQVGSPGCCIITKMPILREEDEIEPRPVFEKKPLVWEEDMELYSKFLDRKEEL 321

  Fly   359 YENATSYLSSNSQLADFMQDYVLNLLRYKPSNVLEFSIMFF 399
            .....|||..:.:....:.|::|.||..:|.:|:.|:..||
Human   322 RLGHASYLRQHPEAHALISDFLLFLLLRQPEDVVTFAAEFF 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13243NP_001260475.1 DD_R_PKA 371..404 CDD:295380 9/29 (31%)
CATIPNP_001307794.1 DD_R_PKA 333..>362 CDD:295380 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12286
eggNOG 1 0.900 - - E1_28H6N
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I5497
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007943
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.