DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13243 and Catip

DIOPT Version :9

Sequence 1:NP_001260475.1 Gene:CG13243 / 34933 FlyBaseID:FBgn0028903 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001366386.1 Gene:Catip / 241112 MGIID:2685062 Length:553 Species:Mus musculus


Alignment Length:356 Identity:74/356 - (20%)
Similarity:130/356 - (36%) Gaps:109/356 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 ENLKIFFERELE----------------QIGRF---------CLNVEESFDGYVIFSSSKMKKGK 147
            |::.:||...|.                |.|::         ||.|..|..|::         .|
Mouse    63 EDMLLFFPETLAILSDTGEPQGELTIEVQRGKYKDDIGILTHCLLVHASSRGFL---------DK 118

  Fly   148 GMTECGHQLKGKYDDKFLLICEKRSEFDRIDNTRVEKTLE-LRNHADLMLTAIRETKINEEV--- 208
            .:  ||..|.|..::...|:.:...||.:.....:|:.:. |:.....::|  |..|..||.   
Mouse   119 SL--CGSSLLGYLNNNLELMEQHSQEFIKFPVLPMERKMSVLKQDGQFVVT--RSVKEGEETKTG 179

  Fly   209 ------QRFKARIDIKDRDHVFVLDGGIMLLMRHLVCNNFV-GNFEYYTMNLYGRVLRCNLVVSK 266
                  :.||.          ||.....::|:|.:.....| ....:..::..|::..|      
Mouse   180 VSVFPYKTFKG----------FVSSAANVVLLRVMAWQQSVPSGARFLALDSEGKLCHC------ 228

  Fly   267 ERKEVRIFYRTYKNV----VHIFTQQCFNDELQDVAETFMTPEGRIVLHYWRGYNYLL---HAA- 323
                      |||::    :.:..||.   ::..|.:|..:.||   :.:...| |||   |.| 
Mouse   229 ----------TYKSLGFQTIQVGNQQA---KMFIVEQTIHSEEG---IPFSCQY-YLLPDGHLAK 276

  Fly   324 ---------C----MPPKRKE------PILPKLELMWRQNEQLSRKFRELKALNYENATSYLSSN 369
                     |    ||..|:|      |...|..|:|.::.:|..||.:.|.....:..|||..:
Mouse   277 RVQVGSPGCCIITKMPLIREEDVIESPPTFDKKPLVWGEDLELYSKFLDRKEQLRLSHASYLRHH 341

  Fly   370 SQLADFMQDYVLNLLRYKPSNVLEFSIMFFQ 400
            .:....:.|::|.||..:|.:|:.|:...|:
Mouse   342 PEAQALVSDFLLFLLLRRPEDVVTFAAEHFR 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13243NP_001260475.1 DD_R_PKA 371..404 CDD:295380 8/30 (27%)
CatipNP_001366386.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007943
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.