DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment t-Grip91 and Tubgcp5

DIOPT Version :10

Sequence 1:NP_723933.1 Gene:t-Grip91 / 34931 FlyBaseID:FBgn0028901 Length:1931 Species:Drosophila melanogaster
Sequence 2:NP_666302.2 Gene:Tubgcp5 / 233276 MGIID:2178836 Length:1024 Species:Mus musculus


Alignment Length:254 Identity:52/254 - (20%)
Similarity:85/254 - (33%) Gaps:81/254 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DETCLMLSNLLT-RSNRMASKAPTICDGTANAVDAKLSE-IDRELSISVITEEDTEPVLDLLKRF 94
            |:.|.:  |:|| .:||:.::.   |....:|.:...|. |:..||.:.:.:...|.:..|||..
Mouse  1165 DKHCTL--NILTLNNNRITAEG---CAALTSAFNLNPSHLIELNLSGNKLGDSGVEKICPLLKNT 1224

  Fly    95 FFKDEPLNTYVQLGECKELEKYCTKSLGEHSSYKAVNSRGEIVGVILNGTIMKPQPGDEPPAKLA 159
            ..:.|.||    |.:|....|      |..:...|:.|...::.:.|.|.    .||.....||.
Mouse  1225 QCRLEKLN----LSDCSITGK------GYETLISALKSNSHLIELDLRGN----DPGKSGVQKLT 1275

  Fly   160 DNCAHPKFRKIMALMDHVDEQFDIFELYPDIDRFLDCKIISVDTNYRGMGIAGMLTDRTLDYASR 224
                                         |:.|...||:.::.|      :.|.......||.::
Mouse  1276 -----------------------------DLLRAGSCKLKTIRT------LKGSAAQEACDYLTK 1305

  Fly   225 ----------------------NGIKLIHVLCSSHFSARVMEKMDFNEVYRLPYADYLV 261
                                  :|.||..:|..||..   :||:..|...:|.....||
Mouse  1306 AVGKSPLLLTELDLSEDKLGDLDGEKLSALLMDSHSK---VEKIRMNNCKKLTEKSCLV 1361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
t-Grip91NP_723933.1 GCP_N_terminal 1312..1591 CDD:465456
GCP_C_terminal <1690..1906 CDD:461187
Tubgcp5NP_666302.2 GCP5_NTD 15..108 CDD:439339
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..203
GCP_N_terminal 271..588 CDD:465456
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 523..545
GCP_C_terminal 716..1017 CDD:461187
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 853..873
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.