DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ku80 and SEC14

DIOPT Version :9

Sequence 1:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_013796.1 Gene:SEC14 / 855103 SGDID:S000004684 Length:304 Species:Saccharomyces cerevisiae


Alignment Length:193 Identity:47/193 - (24%)
Similarity:76/193 - (39%) Gaps:52/193 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 TQQPR----PWAQNDLLPFDALPSIFEQNVMDILERKVIYDNDKEDKMLKDKNFADVFWRVPDPL 503
            |||.:    .:.||  .|.||||.  ....:|..:.|.:.:   ..|:|:|..|.:   |:.|..
Yeast     3 TQQEKEFLESYPQN--CPPDALPG--TPGNLDSAQEKALAE---LRKLLEDAGFIE---RLDDST 57

  Fly   504 EEKSKRAAAIVKKLFPLRYSRAWQ-EKLLAKEQAENGVAVKSEPAEKEIPLPSDGVGLIDPISDF 567
                           .||:.||.: :..||||..||     .|...|:.     |...|  :.||
Yeast    58 ---------------LLRFLRARKFDVQLAKEMFEN-----CEKWRKDY-----GTDTI--LQDF 95

  Fly   568 ----RRVLASVH-TISNATERDAR---FQALAADT--RVVIITLLQRRKQNIGQLGELITLYR 620
                :.::|..: ...:.|::|.|   |:.|.|..  .:..:|..:|..:|:....|.:..||
Yeast    96 HYDEKPLIAKFYPQYYHKTDKDGRPVYFEELGAVNLHEMNKVTSEERMLKNLVWEYESVVQYR 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ku80NP_609767.2 Ku_N 7..213 CDD:281693
KU80 221..524 CDD:238445 20/84 (24%)
Ku_PK_bind 562..663 CDD:285938 15/69 (22%)
SEC14NP_013796.1 CRAL_TRIO_N 34..79 CDD:215024 17/70 (24%)
SEC14 99..269 CDD:214706 13/60 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.