DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ku80 and Sec14l2

DIOPT Version :9

Sequence 1:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_653103.1 Gene:Sec14l2 / 67815 MGIID:1915065 Length:403 Species:Mus musculus


Alignment Length:246 Identity:45/246 - (18%)
Similarity:86/246 - (34%) Gaps:70/246 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   482 KEDKMLK-DKNFADVFWRVPDP--------LEEKS---KRAAAIVKKLFPLRYSR------AWQE 528
            :|:.:.| .:|..||...:|:|        |..:|   :::.|:::|....|..:      :||.
Mouse    12 QEEALAKFRENVQDVLPTLPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDKIISWQP 76

  Fly   529 KLLAKEQAEN---GVAVKSEPAEKEIPLPSDGVGLIDPISDFRRVLASVHTISNATERDARF--- 587
            ..:.::....   |..:...|...:|..|.|..||:        ..||...:.....||...   
Mouse    77 PEVIQQYLSGGRCGYDLDGCPVWYDIIGPLDAKGLL--------FSASKQDLLRTKMRDCELLLQ 133

  Fly   588 ----QALAADTRVVIITLL---------QRRKQNIGQLGELITLYRQSCIDFNTFLEYDKFAEEL 639
                |......::..||::         ...|..:...||.:|::.::            :.|.|
Mouse   134 ECIQQTTKLGKKIETITMIYDCEGLGLKHLWKPAVEAYGEFLTMFEEN------------YPETL 186

  Fly   640 KKIALAKNRSEFWQDVMVDKQLGPLV--LGEPTLDDELALKAYYTIENWVE 688
            |::.:.|           ..:|.|:.  |.:|.|.::...|......||.|
Mouse   187 KRLFVVK-----------APKLFPVAYNLIKPFLSEDTRRKIMVLGANWKE 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ku80NP_609767.2 Ku_N 7..213 CDD:281693
KU80 221..524 CDD:238445 12/53 (23%)
Ku_PK_bind 562..663 CDD:285938 16/116 (14%)
Sec14l2NP_653103.1 CRAL_TRIO_N 13..59 CDD:215024 10/45 (22%)
SEC14 76..244 CDD:214706 31/182 (17%)
GOLD_2 300..381 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.