DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ku80 and clvs2

DIOPT Version :9

Sequence 1:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_001020716.1 Gene:clvs2 / 566769 ZFINID:ZDB-GENE-041014-313 Length:329 Species:Danio rerio


Alignment Length:356 Identity:68/356 - (19%)
Similarity:115/356 - (32%) Gaps:126/356 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LKSAKCVAEILKDKIVCDRKDYVSFVLVGCDTDEIKTEDASHPNVLPFGEPR----LCSWQLLLE 84
            |:.||...:...|.:..|.::....::...|...::|:||.   :|.|...|    ..:::||.:
Zfish    13 LEKAKVELKENPDTLHQDIQEVRDMIITRPDIGFLRTDDAF---ILRFLRARKFNHFEAFRLLAQ 74

  Fly    85 FFQ--------FVNKTACEDGEWLNGLQAALE--LQNVATTLRVARRRILLLFDFNDFPQDYEKF 139
            :|:        |.|..|.:.     |::.||:  ...|.:.|....|:||:||..| :.|....|
Zfish    75 YFEYRQQNLDMFKNLKATDP-----GIKQALKDGFPGVLSNLDRYGRKILVLFAAN-WDQSRYTF 133

  Fly   140 NEI-------------TDELLGENIELIVGTHNIAYIDNAITSQPQAI--------FNFSRKCGP 183
            .:|             ..||......||:...|..: ..|....|..:        .:|..:.|.
Zfish   134 VDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTF-KQASKLTPSMLRLAIEGLQDSFPARFGG 197

  Fly   184 DELNNQKYALSLVPRCNATLCSFKEALHTVFKVTNRRPWVWNAKLNIGSKISISLQGIIAMKNQT 248
            ....||.:              :..||:||.     ||:                     :|::|
Zfish   198 IHFVNQPW--------------YIHALYTVI-----RPF---------------------LKDKT 222

  Fly   249 PVKLVKVWAEKDEIVIRETRHYIKGTEITPLPENLITGYM---LGGTPVPYDEAVLEPKEPHPPG 310
                             ..|.::.|..:..|.:.::...:   |||...|||             
Zfish   223 -----------------RKRIFMHGNNLNSLHQLILPEILPSELGGMLPPYD------------- 257

  Fly   311 LHFFGFIKRNAVPDEY-----FCGESLYLLV 336
               .|...|..:...|     :|.||..|.|
Zfish   258 ---MGTWARTLLDHAYDEETDYCPESYTLSV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ku80NP_609767.2 Ku_N 7..213 CDD:281693 45/223 (20%)
KU80 221..524 CDD:238445 20/124 (16%)
Ku_PK_bind 562..663 CDD:285938
clvs2NP_001020716.1 CRAL_TRIO_N 29..75 CDD:215024 10/48 (21%)
SEC14 106..251 CDD:238099 34/203 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..329
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.