Sequence 1: | NP_609767.2 | Gene: | Ku80 / 34930 | FlyBaseID: | FBgn0041627 | Length: | 699 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001093463.1 | Gene: | sec14l8 / 558964 | ZFINID: | ZDB-GENE-060526-180 | Length: | 395 | Species: | Danio rerio |
Alignment Length: | 280 | Identity: | 48/280 - (17%) |
---|---|---|---|
Similarity: | 91/280 - (32%) | Gaps: | 90/280 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 464 FEQNVMDILERKVIYDNDKEDKMLKDKNFADVFWRVPDPLEEKSKRAAAIVKKLFPLR------- 521
Fly 522 YSRAWQEKLLAKEQAENGVA---VKSEPAEKEIPLPSDGVGLIDPISDFRRVLASVHTISNATER 583
Fly 584 DARFQALAADTRVVIITLL---------QRRKQNIGQLGELITLYRQSCIDFNTFLEYDKFAEEL 639
Fly 640 KKIALAKNRSEF-------------------------WQDVMVDKQLGPLVL------------G 667
Fly 668 EP------TLDDELALKAYY 681 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ku80 | NP_609767.2 | Ku_N | 7..213 | CDD:281693 | |
KU80 | 221..524 | CDD:238445 | 10/66 (15%) | ||
Ku_PK_bind | 562..663 | CDD:285938 | 21/134 (16%) | ||
sec14l8 | NP_001093463.1 | CRAL_TRIO_N | 13..59 | CDD:215024 | 8/52 (15%) |
SEC14 | 78..246 | CDD:214706 | 29/181 (16%) | ||
GOLD_2 | 304..382 | CDD:290608 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1471 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |