DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ku80 and sec14l8

DIOPT Version :9

Sequence 1:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_001093463.1 Gene:sec14l8 / 558964 ZFINID:ZDB-GENE-060526-180 Length:395 Species:Danio rerio


Alignment Length:280 Identity:48/280 - (17%)
Similarity:91/280 - (32%) Gaps:90/280 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   464 FEQNVMDILERKVIYDNDKEDKMLKDKNFADVFWRVPDPLEEKSKRAAAIVKKLFPLR------- 521
            |.:.|.|:|.:.....:....:.|:.:||             ..:::.|:::|....|       
Zfish    19 FREKVQDVLPQCPSQSDHFLLRWLRARNF-------------NLQKSEAMLRKHIEFRKHMKVDT 70

  Fly   522 YSRAWQEKLLAKEQAENGVA---VKSEPAEKEIPLPSDGVGLIDPISDFRRVLASVHTISNATER 583
            .:..||...:..:....|:.   .:..|...::..|.|..||:...|....:.:.|.. ....::
Zfish    71 ITTEWQVPEVIDKYLSGGMCGHDREGSPVWYDVIGPLDPKGLMHSASKQDLIKSKVRD-CEILQK 134

  Fly   584 DARFQALAADTRVVIITLL---------QRRKQNIGQLGELITLYRQSCIDFNTFLEYDKFAEEL 639
            |...|:......:..||::         ...|..|...||::|::.            |.:.|.|
Zfish   135 DCDRQSERLGRNIESITMVYDCEGLGMKHLYKPAIETYGEVLTMFE------------DNYPEGL 187

  Fly   640 KKIALAKNRSEF-------------------------WQDVMVDKQLGPLVL------------G 667
            |::.:.|....|                         ||:|: .|.:.|..|            |
Zfish   188 KRLFVIKAPKLFPVAYNLVKHFLSEDTRRKVIVLGSNWQEVL-QKYIDPEELPAYYGGKLTDPDG 251

  Fly   668 EP------TLDDELALKAYY 681
            :|      |...|:. |:||
Zfish   252 DPKCRTRITFGSEIP-KSYY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ku80NP_609767.2 Ku_N 7..213 CDD:281693
KU80 221..524 CDD:238445 10/66 (15%)
Ku_PK_bind 562..663 CDD:285938 21/134 (16%)
sec14l8NP_001093463.1 CRAL_TRIO_N 13..59 CDD:215024 8/52 (15%)
SEC14 78..246 CDD:214706 29/181 (16%)
GOLD_2 304..382 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.