Sequence 1: | NP_609767.2 | Gene: | Ku80 / 34930 | FlyBaseID: | FBgn0041627 | Length: | 699 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_056582.1 | Gene: | Ttpa / 50500 | MGIID: | 1354168 | Length: | 278 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 41/196 - (20%) |
---|---|---|---|
Similarity: | 60/196 - (30%) | Gaps: | 71/196 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 498 RVPDPLEEKSKRAAAIVKKLFPLRYSRAWQEKL-LAKEQAENGVAVKSEPAEKEIPL-PSDGVGL 560
Fly 561 IDPISDFRRVLASVHTISNATERDARFQALAADTRVVIITLLQRRKQNIGQLGELITLYRQSCID 625
Fly 626 FNTFLEYDKFAEELKKIALAKNRSEFWQDVMVDKQLGPLVLGEPTLDDELALKAYYTIENWVESG 690
Fly 691 A 691 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ku80 | NP_609767.2 | Ku_N | 7..213 | CDD:281693 | |
KU80 | 221..524 | CDD:238445 | 6/25 (24%) | ||
Ku_PK_bind | 562..663 | CDD:285938 | 17/100 (17%) | ||
Ttpa | NP_056582.1 | CRAL_TRIO_N | 25..73 | CDD:215024 | 11/41 (27%) |
CRAL_TRIO | 99..248 | CDD:279044 | 23/126 (18%) | ||
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000269|PubMed:23599266, ECO:0007744|PDB:3W67 | 190..192 | ||||
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000269|PubMed:23599266, ECO:0007744|PDB:3W68 | 208..211 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1471 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |