DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ku80 and CG33966

DIOPT Version :9

Sequence 1:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster


Alignment Length:294 Identity:58/294 - (19%)
Similarity:105/294 - (35%) Gaps:86/294 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 PALRTTKTECSE---EQLNAIDQLIDSTDLECTLRD--TQQPRPWAQNDLLPFDALPSIFEQNVM 469
            ||:|....|..:   |.||.:...:|  |....|||  .|||...|:.|    |.....|.:...
  Fly     2 PAIRPLSPELQKTAIENLNEVPNKLD--DDIAALRDWIKQQPHLKARTD----DQFLVNFLRGCK 60

  Fly   470 DILER---KV--------------IYDNDKEDKMLKDKNFADVFWRVPDPLEEKSKRAAAIVKKL 517
            ..|||   |:              :..|...||.|:......:. .:|.||.:...|.|.:....
  Fly    61 FSLERTKSKIDRFYTLRTKYPEFYLGHNVDVDKALEIFRLGTIV-ILPRPLNDNGPRLALLRMAC 124

  Fly   518 F-PLRY-----SRA---WQEKLLAKEQAE--NGVA-------------VKSEPA---------EK 549
            : |.:|     :||   .|:.:|.::...  ||:.             ::..|:         |:
  Fly   125 YDPSKYTLQEVNRAAGLMQQIMLDEDDVAIVNGLISILDLSNVTTGHFLQMSPSFAKKMTVFQEE 189

  Fly   550 EIPLPSDGVGLIDPISDFRRVLASVHTISNATER------DARFQALAADTRVVIITLLQRRKQN 608
            .:||...|:..|:..:.|..:...:..:.:..::      .::::||          ..|..||.
  Fly   190 ALPLRPQGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKWEAL----------YNQIPKQY 244

  Fly   609 I--------GQLGELITLYRQSCIDFNTFLEYDK 634
            :        |.:.||:..:.|..:.:..:.|.:|
  Fly   245 LPVEYGGENGSIPELLQQWEQRILAYRNYWEEEK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ku80NP_609767.2 Ku_N 7..213 CDD:281693
KU80 221..524 CDD:238445 34/141 (24%)
Ku_PK_bind 562..663 CDD:285938 12/87 (14%)
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 14/45 (31%)
SEC14 96..252 CDD:238099 25/166 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.