DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ku80 and Sec14l3

DIOPT Version :9

Sequence 1:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_001025108.1 Gene:Sec14l3 / 380683 MGIID:3617848 Length:401 Species:Mus musculus


Alignment Length:406 Identity:79/406 - (19%)
Similarity:131/406 - (32%) Gaps:138/406 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 LVPRCNATLCSFKEALHTVFKVTNRRPWVWNAKLNIGSKISISLQGIIAMKNQTPVKLVKVW--- 256
            |.|:...||..|:|.:..|                           :.|:.|.....|:: |   
Mouse     8 LSPKQAETLAKFRENVQDV---------------------------LPALPNPDDYFLLR-WLRA 44

  Fly   257 ----AEKDEIVIRETRHYIKGTEITPL----PENLITGYMLG--------GTPVPYDEAVLEPKE 305
                .:|.|.::|:...:.|..:|..:    |..:|..||.|        |.||.||  ::.|.:
Mouse    45 RNFDLQKSEAMLRKYMEFRKTMDIDHILDWQPPEVIQKYMPGGLCGYDRDGCPVWYD--IIGPLD 107

  Fly   306 PHPPGLHFFGFIKRNAVPDEYFCGESLYLLVHQKHNQSAAV--KLDALVRALVSSDRAIL-CWK- 366
              |.|| .|...|::.:..:.   .....::|:...|:..:  |::.:|.........:. .|| 
Mouse   108 --PKGL-LFSVTKQDLLKTKM---RDCERILHECDLQTERLGRKIETIVMIFDCEGLGLKHFWKP 166

  Fly   367 ---IYSTKFNRPQMVVLLPRLADDTHPATL-YMLEVSYTSQHHFWDFP-ALRTTKTECSEEQLNA 426
               :|...|.          |.::.:|.|| :||.|..|..     || .....|...||:....
Mouse   167 LVEVYQEFFG----------LLEENYPETLKFMLIVKATKL-----FPVGYNLMKPFLSEDTRRK 216

  Fly   427 IDQLIDSTDLECTLRDTQQPRPWAQNDLLPFDALPSIFEQNVMDILERKVIYDNDKEDKMLKDKN 491
            |..|..::..|..|:            |:..:.||:.|         ...:.|.|...|.|...|
Mouse   217 IVVLGSNSWKEGLLK------------LISPEELPAHF---------GGTLTDPDGNPKCLTKIN 260

  Fly   492 FADVFWRVPDPLEEKSKRAAAIVKKLFPLRYSRAWQEKLLAKEQAENGVAV---KSEPAEKEIPL 553
            :..   .:|..:..:.:                       .|.|.|:.|.:   .|...|.||..
Mouse   261 YGG---EIPKSMYVRDQ-----------------------VKTQYEHSVQISRGSSHQVEYEILF 299

  Fly   554 P---------SDGVGL 560
            |         |||..:
Mouse   300 PGCVLRWQFSSDGADI 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ku80NP_609767.2 Ku_N 7..213 CDD:281693 6/17 (35%)
KU80 221..524 CDD:238445 60/330 (18%)
Ku_PK_bind 562..663 CDD:285938
Sec14l3NP_001025108.1 CRAL_TRIO_N 13..59 CDD:215024 12/73 (16%)
SEC14 76..246 CDD:214706 45/213 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.