DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ku80 and CG1902

DIOPT Version :9

Sequence 1:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster


Alignment Length:153 Identity:34/153 - (22%)
Similarity:56/153 - (36%) Gaps:33/153 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 DKNFADVF-----WRVPDPLEEKSKRAAAIVKKLFPLRYSRAWQEKLLAKEQAENGVAVKSEPAE 548
            |..|...|     |.|    ||..||.      ||...|....:|.|..::..:..:.:......
  Fly    48 DDQFLVAFLRFCRWDV----EEAKKRV------LFYYTYKSKERELLKGRQVDDKLIELARSGIF 102

  Fly   549 KEIPLPSDGVGLIDPISDFRR---VLASVHTISNATERDARFQALAADTRVVIITLLQRRKQNIG 610
            ..:|.|   :|...|...:.|   :..|.|::|:.    .||.|..|:     |.:......||.
  Fly   103 ATLPKP---IGPGGPRIHYTRMGHIEPSKHSVSDI----FRFHAFRAE-----IEINTDDNWNIA 155

  Fly   611 QLGELITLYRQSCIDFNTFLEYD 633
            .:.|:|...:   |.::..|::|
  Fly   156 GVVEIIDFTK---IPYSLLLQFD 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ku80NP_609767.2 Ku_N 7..213 CDD:281693
KU80 221..524 CDD:238445 12/39 (31%)
Ku_PK_bind 562..663 CDD:285938 17/75 (23%)
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 7/24 (29%)
CRAL_TRIO 100..248 CDD:279044 20/91 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.