DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ku80 and CG10026

DIOPT Version :9

Sequence 1:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster


Alignment Length:318 Identity:64/318 - (20%)
Similarity:112/318 - (35%) Gaps:111/318 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VRTCAAEEVKLKSAKCVAEILKDKIVCDRKDYVSFVLVGCDTDEIKTEDASHPNVLPFGEPRLC- 77
            :|..|.|:.:..|:       |||::...::|:      .:.:|.:...:....:..|...|.. 
  Fly    28 IRRLAQEQGECPSS-------KDKVIEQFRNYI------LEHNECQPHRSDAKYLEKFLRARYWK 79

  Fly    78 ---SWQLLLEFFQF--VNKTACEDGEWLNGLQAALELQNV-------ATTLRVARRRILLLFDFN 130
               |::||..:::|  .||:..|.       ...|:|::|       .|..|......:|::.|.
  Fly    80 IENSYKLLCSYYRFREQNKSFYEK-------VRPLDLRHVGQSDILTVTPYRDQHGHRILIYRFG 137

  Fly   131 DFPQDYEKFNEIT-DEL---------LG--ENIELIVGTHNI-----AYIDNAITSQPQAIFNFS 178
            .:     :.|::| |::         ||  |.|..|||...|     ..:::.:...|...    
  Fly   138 LW-----RPNQVTVDDIFRATIVLQELGSLEPISQIVGGVGIFDLKDLGLEHILHLSPSVA---- 193

  Fly   179 RKCGPDELNNQKYALSLVPRCNATLCSFKEALHTVFKVTNRRPWVWNAKLNIGSKISISLQGIIA 243
                      ||....||    .::.....|||.|     .:.||:||..               
  Fly   194 ----------QKMIALLV----TSMPIRTSALHIV-----NQNWVFNAAF--------------- 224

  Fly   244 MKNQTPVKLVKVWAEKDEIVIRETRHYIKGTEITPL-----PENLITGYMLGGTPVPY 296
                      |::.......:|| :.||.|:::|.|     ||:|...|  ||....|
  Fly   225 ----------KIFKPFLNAAMRE-KLYIHGSDMTSLHKHINPEHLPKRY--GGLHEDY 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ku80NP_609767.2 Ku_N 7..213 CDD:281693 44/228 (19%)
KU80 221..524 CDD:238445 19/81 (23%)
Ku_PK_bind 562..663 CDD:285938
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 9/52 (17%)
SEC14 112..265 CDD:238099 42/208 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.