DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ku80 and EndoGI

DIOPT Version :9

Sequence 1:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_001260489.1 Gene:EndoGI / 34953 FlyBaseID:FBgn0028515 Length:359 Species:Drosophila melanogaster


Alignment Length:161 Identity:46/161 - (28%)
Similarity:78/161 - (48%) Gaps:14/161 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 LAKEQAENGVAVKSEPAEKEIPLPSDGVGLIDPISDFRRVLASVHTISNATERDA---RFQALAA 592
            ::|.:||:..:.|...||| :......:||:||:.|:::::.:...:....:.|.   .|...||
  Fly     1 MSKRKAEDTQSDKMATAEK-VAQNDYTIGLVDPVKDYQKLIETRVQVDEIVDDDVTKENFDRTAA 64

  Fly   593 DTRVVIITLL----QRRKQNIGQLGELITLYR-QSCIDFNTFLEYDKFAEELKKIALAKNRSEFW 652
            ..|.||..||    ...:.|..:..:|:..|| .:|  |.....|:::..:|:...|.|...:||
  Fly    65 AARDVIWRLLFDEAGTSQSNTEKASQLLEEYRGDAC--FYDPTPYNEWIVKLRDEVLKKELLDFW 127

  Fly   653 QDVMVDKQLGPLVLGEPTL---DDELALKAY 680
            :||:|.|||||....:..|   ||...|:.|
  Fly   128 RDVLVKKQLGPCWSRDSDLFDSDDTPPLEFY 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ku80NP_609767.2 Ku_N 7..213 CDD:281693
KU80 221..524 CDD:238445
Ku_PK_bind 562..663 CDD:285938 30/108 (28%)
EndoGINP_001260489.1 Ku_PK_bind 31..138 CDD:285938 30/108 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449729
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003754
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12604
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.