DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ku80 and ttpal

DIOPT Version :9

Sequence 1:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster
Sequence 2:XP_021325407.1 Gene:ttpal / 321577 ZFINID:ZDB-GENE-030131-296 Length:360 Species:Danio rerio


Alignment Length:277 Identity:52/277 - (18%)
Similarity:90/277 - (32%) Gaps:108/277 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 DRAILCWKIYSTKFNRPQMVVLL----------PRLADDTHPATL-YMLEVSYTS-------QHH 405
            |.|.|...:.:.||:..:.:.||          |.:..|..|:|: ::|::.:.:       |..
Zfish    95 DDAFLLRFLRARKFDYDRALQLLLNYHASRRAWPEVFQDLKPSTVKHVLDLGFLTVLPRPDPQGR 159

  Fly   406 F--------W---DFPALRTTKT---------ECSEEQLNAIDQLIDSTDLECTLRDTQQPRPWA 450
            :        |   |:|.:...:.         :..|.|:|.:..|:|...:  .|.....|.|  
Zfish   160 YILCLRPGKWKPNDYPFVDNIRAIYLTLEKLIQPEETQVNGVVILVDYAGV--GLSQASNPGP-- 220

  Fly   451 QNDLLPFDALPSIFEQNVMDILERKVIYDNDKEDKMLKDKN-------FADVFWRVPDPLEEK-- 506
                        :..:.|:.||:       |.....:|..|       |..:|..:...|:||  
Zfish   221 ------------LLAKKVVGILQ-------DGFPIRIKAVNIINEPRIFKGIFAIIKPFLKEKMA 266

  Fly   507 -------SKRAA---AIVKKLFPLRYS--------RAWQEKLLAKEQAENGVAVKSEPAEKEI-- 551
                   |..|:   .|.:.:.|..|.        .||...||              .||:|.  
Zfish   267 ERYVLHGSDLASLHRVIPQSVLPQEYGGVSGRLDMSAWSRTLL--------------EAEEEFVV 317

  Fly   552 ----PLPSDGVGLIDPI 564
                |.|.:||.:.|.:
Zfish   318 EFCQPDPLEGVIMPDAL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ku80NP_609767.2 Ku_N 7..213 CDD:281693
KU80 221..524 CDD:238445 40/229 (17%)
Ku_PK_bind 562..663 CDD:285938 1/3 (33%)
ttpalXP_021325407.1 CRAL_TRIO_N 74..120 CDD:215024 7/24 (29%)
SEC14 142..294 CDD:238099 29/174 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.