DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ku80 and CG3823

DIOPT Version :9

Sequence 1:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster


Alignment Length:139 Identity:33/139 - (23%)
Similarity:48/139 - (34%) Gaps:51/139 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 PQMV--VLLPRLADDTH---PATLYMLEVSY----TSQHHFWDFPALRTTKTECSEEQLNAIDQL 430
            ||.:  :||.|....|.   .|...:||::|    ...|.|.|...|     :.|.:||..:   
  Fly    31 PQNISRLLLRRFLHTTRGDLSAAQRLLELNYGLRNKHAHIFIDRDPL-----DASSQQLLQV--- 87

  Fly   431 IDSTDLECTLRDTQQPRPWAQNDLLPFDALPSIFEQNVMDILERKVIYDNDKEDKMLKDKNFA-- 493
                                 .||:|   ||.:..:|...:..|.:.:|.||       .||.  
  Fly    88 ---------------------ADLVP---LPGLTPENNKLLFYRLIDFDADK-------FNFTAA 121

  Fly   494 -DVFWRVPD 501
             .||:.|.|
  Fly   122 IKVFFMVAD 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ku80NP_609767.2 Ku_N 7..213 CDD:281693
KU80 221..524 CDD:238445 33/139 (24%)
Ku_PK_bind 562..663 CDD:285938
CG3823NP_572313.1 SEC14 90..239 CDD:238099 15/51 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.