DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ku80 and Ttpal

DIOPT Version :9

Sequence 1:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_001100007.1 Gene:Ttpal / 296349 RGDID:1305754 Length:343 Species:Rattus norvegicus


Alignment Length:325 Identity:61/325 - (18%)
Similarity:105/325 - (32%) Gaps:105/325 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DTDEIKTEDASHPNVLPFGEPRL-----------CSWQLLLEFFQFVNKTACEDGEW-LNGLQAA 106
            ::|.::|.    |:|....|..|           ||  |..:......:...|..|| |..:||.
  Rat     4 ESDSVRTS----PSVASLSENELPPPPPEPPGYVCS--LTEDLVTKAREELQEKPEWRLRDVQAL 62

  Fly   107 LEL-----------QNVATTLRVARRRILLLFDFNDFPQDYEKFNEITDELLGENIELIVGTHNI 160
            .::           .:.|..||..|.|   .||::                  ..::|:|..|..
  Rat    63 RDMVRKEYPYLSTSLDDAFLLRFLRAR---KFDYD------------------RALQLLVNYHGC 106

  Fly   161 AYIDNAITSQPQAIFNFSRKCGPDELNNQKYALSLVPRCNATLCSFKEALHTVFKVTNRRP--WV 223
            .      .|.|:...|.......|.||:.  .|:::|..:...|          .|...||  |:
  Rat   107 R------RSWPEVFSNLRPSALKDVLNSG--FLTVLPHTDPRGC----------HVLCIRPDRWI 153

  Fly   224 ---WNAKLNIGSKISISLQGIIAMKNQTPVKLVKVWAEKDEIVIRETRHYIKGTEITPLPENLIT 285
               :....||.: |.::|:.:| ...:|.|..|.:.|:...:.:.:..|:      .|.....:.
  Rat   154 PSNYPITENIRA-IYLTLEKLI-QSEETQVNGVVILADYKGVSLSKASHF------GPFIARKVI 210

  Fly   286 GYMLGGTPVPYDE--------------AVLEPKEPHPPGLHFF----------GFIKRNAVPDEY 326
            |.:..|.|:....              |:::|.........||          ..:.||.:|.||
  Rat   211 GILQDGFPIRIKAVHIVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLSSLHTSLPRNILPKEY 275

  Fly   327  326
              Rat   276  275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ku80NP_609767.2 Ku_N 7..213 CDD:281693 34/181 (19%)
KU80 221..524 CDD:238445 25/135 (19%)
Ku_PK_bind 562..663 CDD:285938
TtpalNP_001100007.1 CRAL_TRIO_N 57..103 CDD:215024 11/66 (17%)
SEC14 122..278 CDD:238099 33/174 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.