DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ku80 and Rlbp1

DIOPT Version :9

Sequence 1:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_001099744.1 Gene:Rlbp1 / 293049 RGDID:1309649 Length:317 Species:Rattus norvegicus


Alignment Length:190 Identity:38/190 - (20%)
Similarity:67/190 - (35%) Gaps:71/190 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 RVPDPLEEKSKRAAAIVKKLFPLRYSRAWQEKLLAKEQAENGVAVKSEPAEKEIPLPSDGVGLID 562
            :..|.|.|:.:.....|::|         ||  |.:.||.:|..:....||              
  Rat    47 KAKDELNEREETRDEAVREL---------QE--LVQAQAASGEELAVAVAE-------------- 86

  Fly   563 PISDFRRVLASVHTISNATERDARFQALAADTRVVIITLLQRRKQNIGQLGELITLYRQSCIDFN 627
                  ||.|          ||:.|          ::..::.||.::|:..||:..|    ::|.
  Rat    87 ------RVQA----------RDSAF----------LLRFIRARKFDVGRAYELLKGY----VNFR 121

  Fly   628 TFLEYDKFAEELKKIALAKNRSEFWQDVMVDK-QLGPLVLGEPTLDDELALKAYYTIENW 686
              |:|.:..:.|...||.......:..|:..: :.|.:|:             .:.||||
  Rat   122 --LQYPELFDSLSMEALRCTIEAGYPGVLSSRDKYGRVVM-------------LFNIENW 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ku80NP_609767.2 Ku_N 7..213 CDD:281693
KU80 221..524 CDD:238445 5/25 (20%)
Ku_PK_bind 562..663 CDD:285938 19/101 (19%)
Rlbp1NP_001099744.1 CRAL_TRIO_N 60..117 CDD:215024 21/107 (20%)
CRAL_TRIO 143..292 CDD:279044 7/37 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.