DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ku80 and Sec14l5

DIOPT Version :9

Sequence 1:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_001129182.2 Gene:Sec14l5 / 287060 RGDID:1564638 Length:696 Species:Rattus norvegicus


Alignment Length:405 Identity:86/405 - (21%)
Similarity:133/405 - (32%) Gaps:133/405 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 NVLPFGEPRLCSWQLLLEFFQFVNKTACEDGEWLNGLQAALEL-----QNVATTLRVARRRILLL 126
            |...||.| :.||..||: .:.:|....    |..|::|.|.:     .|...||    .|:|::
  Rat   368 NTRQFGRP-ISSWTCLLD-LEGLNMRHL----WRPGVKALLRMIEVVEDNYPETL----GRLLIV 422

  Fly   127 FDFNDFPQDYEKFNEITDELLGENIE---LIVGTHN-------IAYIDNAITSQPQAIFNFSRKC 181
                ..|:.:.....:....:.||..   ||....|       :.|:|..:.             
  Rat   423 ----RAPRVFPVLWTLVSPFINENTRRKFLIYSGSNYQGPGGLVDYLDKDVI------------- 470

  Fly   182 GPDELNNQKYALSLVPRCNATLCSFKEALHTVFKVTNRRPWVWNAKLNIGSKISISLQGIIAMKN 246
             ||.|..:            ::|:..|                      |..:..||  .:..:.
  Rat   471 -PDFLGGE
------------SVCNVPE----------------------GGMVPKSL--YLTEEE 498

  Fly   247 QTPVKLVKVWAE--KDEIVIRETRHYIKGTEITPLPENLIT---GYMLGGTPVPYDEAVLEPK-E 305
            |.....::.|:|  ....|:|.:.|.: ..|| |..|::||   ..:.|........|...|| .
  Rat   499 QEQADQLRQWSETYHSASVLRGSPHEV-AMEI-PEGESVITWDFDILRGDVVFSLYHAKQAPKLS 561

  Fly   306 PHPPGLHFFG-FIKRN--------AVPDEYFC--GESL-----------YLLVHQKHN--QSAAV 346
            |..||:...| .|.:|        .|.....|  |:|:           |||..|.|:  :|.|.
  Rat   562 PQEPGVRASGQLIDKNWILGVDYSRVEAPLICREGQSIQGSHVTQWPGVYLLQWQIHSPPESVAC 626

  Fly   347 KL---DALVRALVSSDRAILCWKIYSTKFNRPQMVVLLPRLADDTHPATLYMLEVSYTSQHHFWD 408
            .|   |.::.||.|....  |..:|..:.           ||.:....::..|| |..|:     
  Rat   627 SLPGVDDVLTALHSPGPK--CKLLYYCEV-----------LASEDFRGSMSSLE-SCASR----- 672

  Fly   409 FPALRTTKTECSEEQ 423
            |..|..|.|..|..|
  Rat   673 FSQLSATTTSSSSGQ 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ku80NP_609767.2 Ku_N 7..213 CDD:281693 31/160 (19%)
KU80 221..524 CDD:238445 55/236 (23%)
Ku_PK_bind 562..663 CDD:285938
Sec14l5NP_001129182.2 PRELI 17..173 CDD:309720
Amidase <179..309 CDD:327489
CRAL_TRIO_N 243..288 CDD:215024
CRAL_TRIO 314..477 CDD:306996 29/136 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.