DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ku80 and F28H7.8

DIOPT Version :9

Sequence 1:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_505746.2 Gene:F28H7.8 / 185099 WormBaseID:WBGene00009241 Length:410 Species:Caenorhabditis elegans


Alignment Length:280 Identity:52/280 - (18%)
Similarity:96/280 - (34%) Gaps:98/280 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 PFDALPSIFEQNVMDILERKVIYDNDKEDKMLKDKNFADVFWRVPDP-LEEKSKRAAAIVKKLFP 519
            ||.....:..|:..:.:::.::         :...::.:|.|....| :.|:||:.....     
 Worm   178 PFRVSWQLVGQHYREFIDKFIV---------INSPSYINVLWSALSPFIPEQSKQRIVFA----- 228

  Fly   520 LRYSRAWQEKLLAKEQAENGVAVKSEPAEKEIPLPSDGVGLI---------DPI--SDFRRVLAS 573
               ...|:|:||             :..:||. ||....|:|         |||  |.:.::.|.
 Worm   229 ---GSNWKEELL-------------DIVDKEC-LPERYGG
MIPDIQCLKPVDPIPKSLYWKLPAQ 276

  Fly   574 VHT--------ISNATERDARFQALAADTRV---------VIITLLQRRKQNIGQLG-ELITLYR 620
            ..|        :|.:..|...::....||.:         :.|||...:.:|:.:.. ||.....
 Worm   277 YPTMDQLHKVSVSASKHRMLIYKVDKPDTELLMYSHNENDITITLYYSKNKNVSENDLELAVAPI 341

  Fly   621 QSC-------IDFNTFLEYDKFAEELKKIALAKNRS----EFWQDVMVDKQLG----PLVLGEPT 670
            ..|       .|:|  .||..:    ..|.||...|    ..::.::::|:.|    ||.|.   
 Worm   342 PKCGLPAMDLFDYN--CEYPGY----YYIKLANEASWLLPSTYRIIVIEKESGKELEPLNLN--- 397

  Fly   671 LDDELALKAYYTIENWVESG 690
                         |.|::.|
 Worm   398 -------------EKWIKKG 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ku80NP_609767.2 Ku_N 7..213 CDD:281693
KU80 221..524 CDD:238445 9/68 (13%)
Ku_PK_bind 562..663 CDD:285938 27/135 (20%)
F28H7.8NP_505746.2 CRAL_TRIO_N 16..61 CDD:215024
SEC14 93..251 CDD:214706 17/103 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.