powered by:
Protein Alignment Ku80 and cgr-1
DIOPT Version :9
Sequence 1: | NP_609767.2 |
Gene: | Ku80 / 34930 |
FlyBaseID: | FBgn0041627 |
Length: | 699 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_508618.2 |
Gene: | cgr-1 / 180650 |
WormBaseID: | WBGene00020847 |
Length: | 383 |
Species: | Caenorhabditis elegans |
Alignment Length: | 75 |
Identity: | 13/75 - (17%) |
Similarity: | 30/75 - (40%) |
Gaps: | 14/75 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 567 FRRVLASVH--TISNATERDARFQALAADTRVVIITLLQRRKQNIGQLGELITLYRQSCIDFNTF 629
:.:.:|..| |:..|......||...::|.:....:.|..::...::|.:| .
Worm 114 YMQAMAKAHPKTLVKAGPTSQLFQLCISETEMSFKIIRQTEQETERKMGVII------------I 166
Fly 630 LEYDKFAEEL 639
::.|.|:.:|
Worm 167 MDLDGFSMDL 176
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1471 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.