DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ku80 and CLVS1

DIOPT Version :9

Sequence 1:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_775790.1 Gene:CLVS1 / 157807 HGNCID:23139 Length:354 Species:Homo sapiens


Alignment Length:327 Identity:75/327 - (22%)
Similarity:111/327 - (33%) Gaps:115/327 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DTDEIKTEDASHPNVLPFGEPR----LCSWQLLLEFFQ--------FVNKTACEDG---EWLNGL 103
            |...::|:||.   :|.|...|    ..:::||.::||        |.|..|.:.|   ..::|.
Human    65 DIGFLRTDDAF---ILRFLRARKFHQADAFRLLAQYFQYRQLNLDMFKNFKADDPGIKRALIDGF 126

  Fly   104 QAALELQNVATTLRVARRRILLLFDFNDFPQDYEKFNEI------TDELLGENIELIVGTHNIAY 162
            ...||.::      ...|:|||||..| :.|....|.:|      :.|:|.|:.||.:... |..
Human   127 PGVLENRD------HYGRKILLLFAAN-WDQSRNSFTDILRAILLSLEVLIEDPELQINGF-ILI 183

  Fly   163 IDNAITSQPQAIFNFSRKCGPDELNNQKYALSLVPRCNATLCSFKEALHTVFKVT------NRRP 221
            ||.:         |||          .|.|..|.|   :.|....|.|...|...      ..:|
Human   184 IDWS---------NFS----------FKQASKLTP---SILKLAIEGLQDSFPARFGGVHFVNQP 226

  Fly   222 WVWNAKLNIGSKISISLQGIIAMKNQTPVKLVKVWAEKDEIVIRETRHYIKGTEITPL-----PE 281
            |..:|...                      |:|.:. ||:   ...|.::.|..:..|     ||
Human   227 WYIHALYT----------------------LIKPFL-KDK---TRKRIFLHGNNLNSLHQLIHPE 265

  Fly   282 NLITGYMLGGTPVPYD-----EAVLEPKEPHPPGLHFFGFIKRNAVPDEYFCGESLYLLVHQKHN 341
            .|.:.:  |||..|||     ..:|.|.                 ..||.....:.|..:|.||.
Human   266 FLPSEF--GGTLPPYDMGTWARTLLGPD-----------------YSDENDYTHTSYNAMHVKHT 311

  Fly   342 QS 343
            .|
Human   312 SS 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ku80NP_609767.2 Ku_N 7..213 CDD:281693 46/179 (26%)
KU80 221..524 CDD:238445 28/133 (21%)
Ku_PK_bind 562..663 CDD:285938
CLVS1NP_775790.1 CRAL_TRIO_N 51..97 CDD:215024 9/34 (26%)
CRAL_TRIO 125..274 CDD:306996 46/206 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.