DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ku80 and LOC110438490

DIOPT Version :9

Sequence 1:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster
Sequence 2:XP_021326687.1 Gene:LOC110438490 / 110438490 -ID:- Length:214 Species:Danio rerio


Alignment Length:130 Identity:40/130 - (30%)
Similarity:61/130 - (46%) Gaps:16/130 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 SFKEALH--TVFKVTNRRPWVWNAKLNIGSKISISLQGIIAMKNQTPVKLVKVWA-------EKD 260
            :|.:||.  ::||...|||..|..:|.|||.:||.   |:..|..|..|:.|.|.       ::|
Zfish    60 TFSDALEKLSIFKRIERRPMAWPCQLTIGSSLSIR---IVGYKAVTEEKVKKSWTIVDAQSHQRD 121

  Fly   261 EIVIRETRHYIKGTEITPL-PENLITGYMLGGTPVPYDEAVLEPKEPHPPGLHF--FGFIKRNAV 322
            : |.|||.:.:...:.|.: .::.|.||..|...||:.:...|..:....|..|  .||.|:..|
Zfish   122 D-VKRETVYCLNDDDETEVQKDDTIQGYRYGSDIVPFSKVDEEQMKYKHDGKCFSVLGFTKQELV 185

  Fly   323  322
            Zfish   186  185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ku80NP_609767.2 Ku_N 7..213 CDD:281693 3/9 (33%)
KU80 221..524 CDD:238445 33/112 (29%)
Ku_PK_bind 562..663 CDD:285938
LOC110438490XP_021326687.1 KU 78..>187 CDD:322044 33/112 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185892at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.