DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gli and si:dkey-193c22.1

DIOPT Version :9

Sequence 1:NP_476602.1 Gene:Gli / 34927 FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001093504.1 Gene:si:dkey-193c22.1 / 567837 ZFINID:ZDB-GENE-030131-7957 Length:370 Species:Danio rerio


Alignment Length:248 Identity:52/248 - (20%)
Similarity:91/248 - (36%) Gaps:62/248 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 TVDRVMGECSVFLGIPYALP---------PTFEG------RFKPPRVH----RGWQLLQAVDFGP 212
            ::..|.|  ::.:|:||::.         |...|      ..||.|::    ...::|:.:.:|.
Zfish     9 SIPAVAG--ALLVGLPYSISLVAQWLYGWPNKPGYQKYIEALKPRRIYCLARAVLEMLKYLQYGK 71

  Fly   213 ACPQ-PVRYT----------GATKGIMDMDEDCLYLNVYSPKTGAGVAQKYPVMVYIHGGEFIRG 266
            ...| .:.|:          |.|.|......| ||   |||:.........||:|:::||.:..|
Zfish    72 LYFQWKLWYSNDKNNKHYVKGITFGRRGNKLD-LY---YSPRLELSDESPVPVVVFVYGGAWGSG 132

  Fly   267 ASNLFQGHILASFYDVVVVTLNYRLGALGFLSTGDENSPGNY--GILDQAMALRWVYDNIEFFNG 329
            .         .|.|.::.:.:...|.|............||.  .:.|.:.:|.||......|:.
Zfish   133 D---------RSIYCLLALQMAKELNASVICPDYSIYPKGNVLNMVQDISDSLLWVRQKGHAFSL 188

  Fly   330 DRNSITLFGPGAGGASAGL--LMVAPQTRNI-------------VRRVIAQSG 367
            |:::|.|.|..||.....|  |.:|.....:             ::.:|..||
Zfish   189 DQDNIILIGHSAGAHLCALTSLFLASNVEELFIETNKQKDLVTAIKGIIGLSG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 52/248 (21%)
si:dkey-193c22.1NP_001093504.1 Aes 87..336 CDD:223730 38/168 (23%)
Abhydrolase 121..>210 CDD:304388 22/97 (23%)
Abhydrolase 167..336 CDD:304388 17/75 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.