DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gli and CG30095

DIOPT Version :9

Sequence 1:NP_476602.1 Gene:Gli / 34927 FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster


Alignment Length:88 Identity:21/88 - (23%)
Similarity:31/88 - (35%) Gaps:18/88 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 VQGFKVYMYDNPDPKSFYRPYHSTVDRVMGECSVFLGIPYALPPTFEGRFKPPRVHRGWQLLQAV 208
            |.||..|..||. .:||:....|.:.:.   |:.::.:.....|.|:   |........:.|.|.
  Fly    86 VPGFMKYRVDNA-ARSFFNQNDSFIKQF---CTKWIQVKECFRPLFD---KSNNTDVEVETLDAK 143

  Fly   209 DFGPAC-----------PQPVRY 220
            ..|..|           |.||.|
  Fly   144 IQGQRCNCDKLLLSTEPPVPVVY 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 134..695 CDD:278561 21/88 (24%)
CG30095NP_725529.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.