DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gli and nlg-1

DIOPT Version :10

Sequence 1:NP_476602.1 Gene:Gli / 34927 FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001257226.1 Gene:nlg-1 / 181484 WormBaseID:WBGene00006412 Length:847 Species:Caenorhabditis elegans


Alignment Length:51 Identity:12/51 - (23%)
Similarity:28/51 - (54%) Gaps:7/51 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 GQTIIKNFLESYKSLYKLAKDI-VGALKGRDLNSKAYNAETEKLLDELNLC 364
            |.|:...::...::..|.::.: :|::|..:|  |::|.||    |..::|
 Worm   112 GVTVTYQYVHVEETSSKESRMVRLGSMKAEEL--KSFNMET----DSCSIC 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GliNP_476602.1 COesterase 137..695 CDD:395084 12/51 (24%)
PRK13335 818..>918 CDD:139494
nlg-1NP_001257226.1 COesterase 19..595 CDD:395084 12/51 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.