DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and CCNG1

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001350944.1 Gene:CCNG1 / 900 HGNCID:1592 Length:295 Species:Homo sapiens


Alignment Length:171 Identity:53/171 - (30%)
Similarity:81/171 - (47%) Gaps:22/171 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 EQDSR-------LRSISMLEQHPGLQPRMRAILLDW----LIEVCEVYKLHRETFYLAVDYLDRY 396
            ||:||       ||.|.....: ||  ||.|.|.|:    |:.:.:.:....|||.|||:.|||:
Human    22 EQESRCQPKVCGLRLIESAHDN-GL--RMTARLRDFEVKDLLSLTQFFGFDTETFSLAVNLLDRF 83

  Fly   397 LHVAHKVQKTHLQLIGITCLFVAAK--VEEIYPPKIGEFAYVTDGACTERDILNHEKILLQALDW 459
            |. ..|||..||..:|::|.::|.|  .||...|...:...::....|..|::..|||:|:.:.|
Human    84 LS-KMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATDLIRISQYRFTVSDLMRMEKIVLEKVCW 147

  Fly   460 DISPITITGWLGVYMQLNVNN-----RTPASFSQIGRQKSA 495
            .:...|...:|.:|..|...|     |...:|.::..|..|
Human   148 KVKATTAFQFLQLYYSLLQENLPLERRNSINFERLEAQLKA 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 44/131 (34%)
Cyclin_C <517..>571 CDD:281044
CCNG1NP_001350944.1 CYCLIN_CCNG1 51..148 CDD:410286 31/97 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146231
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.