DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and CCND3

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001751.1 Gene:CCND3 / 896 HGNCID:1585 Length:292 Species:Homo sapiens


Alignment Length:253 Identity:65/253 - (25%)
Similarity:106/253 - (41%) Gaps:49/253 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 DSR-LRSISMLEQ------------HPGLQPRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRY 396
            |.| |:|:..||:            ...::|.||.:|..|::||||..:...|.|.||::|||||
Human    24 DQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRY 88

  Fly   397 LHVAHKVQKTHLQLIGITCLFVAAKVEEIYPPKIGEFAYVTDGACTERDILNHEKILLQALDWDI 461
            |... ..:|..|||:|..|:.:|:|:.|..|..|.:....||.|.:.|.:.:.|.::|..|.||:
Human    89 LSCV-PTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDL 152

  Fly   462 SPITITGWLGVYMQLNVNNRTPASFSQIGRQKSAEADDAFIYPQFSGFEFVQTSQLLDLCTLDVG 526
            :.:....:|...:..          ..:.|.:.|...           :..||  .|.||..|..
Human   153 AAVIAHDFLAFILHR----------LSLPRDRQALVK-----------KHAQT--FLALCATDYT 194

  Fly   527 MANYSYSVLA------------AAAISHTFSREMALRCSGLDWQVIQPCARWMEPFFR 572
            .|.|..|::|            |.::|.....|:....:|.:...::.|...:|...|
Human   195 FAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 45/129 (35%)
Cyclin_C <517..>571 CDD:281044 14/65 (22%)
CCND3NP_001751.1 Cyclin_N 27..153 CDD:306612 43/126 (34%)
Cyclin_C 155..>251 CDD:308564 19/118 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146263
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.