DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and CYCD3;2

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001331659.1 Gene:CYCD3;2 / 836861 AraportID:AT5G67260 Length:404 Species:Arabidopsis thaliana


Alignment Length:313 Identity:71/313 - (22%)
Similarity:115/313 - (36%) Gaps:100/313 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 LDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQKTH---LQLIGITCLFVAAKVEEIYPP-- 428
            |||::.|...|.....|..|||:|.||:: .:.|:|...   .||:.:..|.:|||||||..|  
plant   100 LDWVLRVKSHYGFTSLTAILAVNYFDRFM-TSIKLQTDKPWMSQLVAVASLSLAAKVEEIQVPLL 163

  Fly   429 ---KIGEFAYVTDGACTERDILNHEKILLQALDWDISPITITGWLGVYMQLNVNNRTPASFSQIG 490
               ::.|..|:.:....:|    .|.::|..|.|.:.|:                 ||.||..  
plant   164 LDLQVEEARYLFEAKTIQR----MELLILSTLQWRMHPV-----------------TPISFFD-- 205

  Fly   491 RQKSAEADDAFIYPQFSGFEFVQTSQLLDLC----------TLDVGMANYSYSVLAAAAISHTFS 545
                      .|..:|..    :..|.||.|          ..|.....|..||||.|.:...| 
plant   206 ----------HIIRRFGS----KWHQQLDFCRKCERLLISVIADTRFMRYFPSVLATAIMILVF- 255

  Fly   546 REMALRCSGLDWQVIQPCARWMEPFFRVISQKAPYLQLNEQNEQVSNKFGLGLICPNIVTDDSHI 610
             |....|..:::|                ||....|::|::.                |.:...:
plant   256 -EELKPCDEVEYQ----------------SQITTLLKVNQEK----------------VNECYEL 287

  Fly   611 IQTHTTT----MDMYDE-----VLMAQDAAH-AMRARIQASPATALRAPESLL 653
            :..|..:    |::.|:     ||...|::: :......||.:::..:||.||
plant   288 LLEHNPSKKRMMNLVDQDSPSGVLDFDDSSNSSWNVSTTASVSSSSSSPEPLL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 32/100 (32%)
Cyclin_C <517..>571 CDD:281044 14/63 (22%)
CYCD3;2NP_001331659.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.