DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and CYCB1;1

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_195465.1 Gene:CYCB1;1 / 829904 AraportID:AT4G37490 Length:428 Species:Arabidopsis thaliana


Alignment Length:497 Identity:112/497 - (22%)
Similarity:194/497 - (39%) Gaps:132/497 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 SVASSVYTSPVVSVDGQST------QELLSI---------RSSPAEDLSEAPHSPLPDSPDSPPS 201
            |:.....|..||.|||::.      |.|..|         :::..|.::..|.:    ...:|..
plant     6 SIVPQQSTDDVVVVDGKNVAKGRNRQVLGDIGNVVRGNYPKNNEPEKINHRPRT----RSQNPTL 66

  Fly   202 PDRGSKQTPVVVRYAAEQVVTSTVVTQKTEDDDLLDDSCEDYSYDEDDE------DDVEEEDDDV 260
            ....:.:.|||.|.|   |.....|..|.:..|::     :.|.|.|:|      .:.:......
plant    67 LVEDNLKKPVVKRNA---VPKPKKVAGKPKVVDVI-----EISSDSDEELGLVAAREKKATKKKA 123

  Fly   261 EIYSSTISPAS-SGCSQQQAVNGERTPGLPKHQEQIHHPVSDLMINMRTPMSPAVENGLRQCPLP 324
            ..|:|.::..| :.|            ||.|.|::   .:.|:       .|..|||.|      
plant   124 TTYTSVLTARSKAAC------------GLEKKQKE---KIVDI-------DSADVENDL------ 160

  Fly   325 ALAWANAADVWRLMCHRDEQDSRLRSISMLEQHPGLQPRMRAILLDWLIEVCEVYKLHRETFYLA 389
             .|.....|::...   ...:|..|....:...|.:..:||.||::|||:|...::|:.|||||.
plant   161 -AAVEYVEDIYSFY---KSVESEWRPRDYMASQPDINEKMRLILVEWLIDVHVRFELNPETFYLT 221

  Fly   390 VDYLDRYLHVAHKVQKTHLQLIGITCLFVAAKVEEIYPPKIGEFAYVTDGACTERDILNHEKILL 454
            |:.|||:|.| ..|.:..|||:|::.|.::||.|||:||::.:...:.|.|.:.:.||..||.:|
plant   222 VNILDRFLSV-KPVPRKELQLVGLSALLMSAKYEEIWPPQVEDLVDIADHAYSHKQILVMEKTIL 285

  Fly   455 QALDWDISPITITGWLGVYMQLNVNNRTPASFSQIGRQKSAEADDAFIYPQFSGFEFVQTSQLLD 519
            ..|:|.::..|...:|..:::.::.:.              :.::...|....|.....|     
plant   286 STLEWYLTVPTHYVFLARFIKASIADE--------------KMENMVHYLAELGVMHYDT----- 331

  Fly   520 LCTLDVGMANYSYSVLAAAAISHTFSREMALR-----------CSGLDWQVIQPCARWMEPFFRV 573
                   |..:|.|::||:||   ::...:||           .:|.....:..||:.:      
plant   332 -------MIMFSPSMVAASAI---YAARSSLRQVPIWTSTLKHHTGYSETQLMDCAKLL------ 380

  Fly   574 ISQKAPYLQLNEQNE--------------QVSNKFGLGLICP 601
                 .|.|..:|.|              ....:|.:.||.|
plant   381 -----AYQQWKQQEEGSESSTKGALRKKYSKDERFAVALIPP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 46/128 (36%)
Cyclin_C <517..>571 CDD:281044 12/64 (19%)
CYCB1;1NP_195465.1 COG5024 <129..406 CDD:227357 80/349 (23%)
Cyclin_N 168..293 CDD:365896 46/128 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.