DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and CYCB1;4

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_180244.1 Gene:CYCB1;4 / 817217 AraportID:AT2G26760 Length:387 Species:Arabidopsis thaliana


Alignment Length:225 Identity:59/225 - (26%)
Similarity:104/225 - (46%) Gaps:55/225 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 LEQHPGLQP----RMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQKTHLQLIGIT 414
            ::.:.|.||    :||:||:|||::|...::|..||.||.::.:||:|.:. .|.:..|||:|:.
plant   147 IKDYIGSQPEINEKMRSILIDWLVDVHRKFELMPETLYLTINLVDRFLSLT-MVHRRELQLLGLG 210

  Fly   415 CLFVAAKVEEIYPPKIGEFAYVTDGACTERDILNHEKILLQALDWDISPITITGWLGVYMQLNVN 479
            .:.:|.|.|||:.|::.:|..::|.|...:.:|..||.:|..::|.|:..|...:|..|::..| 
plant   211 AMLIACKYEEIWAPEVNDFVCISDNAYNRKQVLAMEKSILGQVEWYITVPTPYVFLARYVKAAV- 274

  Fly   480 NRTPASFSQIGRQKSAEADDAFIYPQFSGFEFVQTSQLLDLCTLDVGMANYSY------SVLAAA 538
               |.         .||.:....|                  ..::|:..|..      |:|||:
plant   275 ---PC---------DAEMEKLVFY------------------LAELGLMQYPIVVLNRPSMLAAS 309

  Fly   539 AISHTFSREMALRCSGLDWQVIQPCARWME 568
            |:       .|.|      |:::....|.|
plant   310 AV-------YAAR------QILKKTPFWTE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 38/111 (34%)
Cyclin_C <517..>571 CDD:281044 12/58 (21%)
CYCB1;4NP_180244.1 CYCLIN_AtCycB-like_rpt1 110..255 CDD:410270 37/108 (34%)
CYCLIN_AtCycB-like_rpt2 260..377 CDD:410215 20/111 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.