DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and CCNP

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:XP_006723458.2 Gene:CCNP / 79935 HGNCID:25805 Length:397 Species:Homo sapiens


Alignment Length:270 Identity:71/270 - (26%)
Similarity:114/270 - (42%) Gaps:66/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 PVSDLMINM-RTPMSPAVENGLRQCPL---------PALAWA-----------NAADVWR--LMC 339
            |:..|..:: ..|.|.||.:|....|.         |.|..|           .|.|::.  ::|
Human    95 PLQSLAASLDAEPSSAAVPDGFPAGPTVSPRRLARPPGLEEALSALGLQGEREYAGDIFAEVMVC 159

  Fly   340 HRDEQDSRLRSISMLEQHPGLQPRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQ 404
                   |:..:..|.:  .:.|.|||:::|||::|.|...|..:|.||||..||.||. |.:|:
Human   160 -------RVLPLRALPR--AVTPEMRALVVDWLVQVHEYLGLAGDTLYLAVHLLDSYLS-AGRVR 214

  Fly   405 KTHLQLIGITCLFVAAKVEEIYPPKIGEFAYVTDGACTERDILNHEKILLQALDWDI---SPITI 466
            ...|||:|:.|||||.|:||...|:......::..:.:..::|..|:.:|..||:.:   .|:..
Human   215 LHRLQLLGVACLFVACKMEECVLPEPAFLCLLSADSFSRAELLRAERRILSRLDFRLHHPGPLLC 279

  Fly   467 TGWLGVYMQLNVNNRTPASFSQIGRQKSAEADDAFIYPQFSGFEFVQTSQLLDLCTLDVGMANYS 531
            .|.|                       :|.|..:   ||.    .:..:..|:|..|:...|.:.
Human   280 LGLL-----------------------AALAGSS---PQV----MLLATYFLELSLLEAEAAGWE 314

  Fly   532 YSVLAAAAIS 541
            ....||||:|
Human   315 PGRRAAAALS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 43/133 (32%)
Cyclin_C <517..>571 CDD:281044 9/25 (36%)
CCNPXP_006723458.2 Cyclin_N 171..271 CDD:278560 39/100 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146252
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.