DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and CCNJL

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_078841.3 Gene:CCNJL / 79616 HGNCID:25876 Length:435 Species:Homo sapiens


Alignment Length:393 Identity:69/393 - (17%)
Similarity:122/393 - (31%) Gaps:138/393 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 AADVWRLMCHRDEQDSRLRSISMLEQHPGLQPRMRAI-LLDWLIEVCEVYKLHRETFYLAVDYLD 394
            |:||     |...::..|:..:.....|.|:.|...: :|..|...|::....|   :|||..||
Human    12 ASDV-----HCTLREKELKLPTFRAHSPLLKSRRFFVDILTLLSSHCQLCPAAR---HLAVYLLD 68

  Fly   395 RYLHVAHKVQKTHLQLIGITCLFVAAKVEEI---------------------------------Y 426
            .::...:......|..:.::||.:|..|..:                                 .
Human    69 HFMDRYNVTTSKQLYTVAVSCLLLANGVSLLSPRLKCSGMISAHCNLHLPGSSNSPASAPHPPPT 133

  Fly   427 PPKIGEFAYVTDG--------------------------ACTERDILNHEKILLQALDWDISPIT 465
            ||::.|    |.|                          ..|::::|:.|.:||:|..|::...|
Human   134 PPQVAE----TTGKFEDREDHVPKLEQINSTRILSSQNFTLTKKELLSTELLLLEAFSWNLCLPT 194

  Fly   466 ITGWLGVYMQLNVNNRT------PASFSQIGRQKSAEADDAFIYPQFSGFEFVQTSQLLDLCTLD 524
            ...:|..|:..:|:.:.      |.:..    :|:.|....:.:            ..|::...|
Human   195 PAHFLDYYLLASVSQKDHHCHTWPTTCP----RKTKECLKEYAH------------YFLEVTLQD 243

  Fly   525 VGMANYSYSVLAAAAISHTFSREMALRCSGLDWQVIQPCARWMEPFFRVISQKAPYLQLNEQNEQ 589
            .....:..||:|||             |.|.....:|....|.....|:.|....:|.       
Human   244 HIFYKFQPSVVAAA-------------CVGASRICLQLSPYWTRDLQRISSYSLEHLS------- 288

  Fly   590 VSNKFGLGLICPNIVTDDSHIIQTHTTTMDMYDEVLMAQDAAHAMRARIQASPATALRAPESLLT 654
                     .|..|:             :.:||.||  :||.......:...|.|.....:.|..
Human   289 ---------TCIEIL-------------LVVYDNVL--KDAVAVKSQALAMVPGTPPTPTQVLFQ 329

  Fly   655 PPA 657
            |||
Human   330 PPA 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 33/188 (18%)
Cyclin_C <517..>571 CDD:281044 11/53 (21%)
CCNJLNP_078841.3 CYCLIN 14..>93 CDD:294043 19/86 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..142 4/25 (16%)
Cyclin_C 193..>295 CDD:281044 23/159 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146234
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.