DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycE and ccnb3

DIOPT Version :9

Sequence 1:NP_001246037.1 Gene:CycE / 34924 FlyBaseID:FBgn0010382 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001070187.1 Gene:ccnb3 / 767751 ZFINID:ZDB-GENE-060929-684 Length:398 Species:Danio rerio


Alignment Length:108 Identity:48/108 - (44%)
Similarity:71/108 - (65%) Gaps:2/108 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 MLEQHPGLQPRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQKTHLQLIGITCLF 417
            |::| |.|...|||||:|||:||.|.::|:.||.||||...|.||.|: :.::..|||||.|.:.
Zfish   163 MVDQ-PNLNTNMRAILVDWLVEVQENFELNHETLYLAVKVTDHYLAVS-QTKREALQLIGSTAML 225

  Fly   418 VAAKVEEIYPPKIGEFAYVTDGACTERDILNHEKILLQALDWD 460
            :|:|.||..||.:.:|.|:.|.|.....:::.|..:||||::|
Zfish   226 IASKFEERAPPCVDDFLYICDDAYKRSQLISMEISILQALNFD 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycENP_001246037.1 Cyclin_N 333..462 CDD:278560 48/108 (44%)
Cyclin_C <517..>571 CDD:281044
ccnb3NP_001070187.1 Cyclin_N 145..270 CDD:278560 48/108 (44%)
Cyclin_C 272..386 CDD:281044
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.